Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2GK1HI)

• DOT Name: CREB3 regulatory factor (CREBRF)
• Synonyms: Luman recruitment factor; LRF
• Gene Name: CREBRF
• Related Disease:
  Acute lymphocytic leukaemia
  Carcinoma
  Central precocious puberty
  Childhood acute lymphoblastic leukemia
  Chondrosarcoma
  Chronic kidney disease
  Depression
  Leukemia
  Neoplasm
  Small lymphocytic lymphoma
  Adult glioblastoma
  Advanced cancer
  Benign prostatic hyperplasia
  Chronic renal failure
  End-stage renal disease
  Gastric cancer
  Glioblastoma multiforme
  Obesity
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Gallbladder cancer
  Gallbladder carcinoma
  Inherited obesity
  Non-insulin dependent diabetes
  Precocious puberty
  Rheumatoid arthritis
• UniProt ID: CRERF_HUMAN
• Sequence:
  MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMNYQQNPRDNFL
  SLEDCKDIENLESFTDVLDNEGALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGL
  DDFSSPYQDEEVISKTPTLAQLNSEDSQSVSDSLYYPDSLFSVKQNPLPSSFPGKKITSR
  AAAPVCSSKTLQAEVPLSDCVQKASKPTSSTQIMVKTNMYHNEKVNFHVECKDYVKKAKV
  KINPVQQSRPLLSQIHTDAAKENTCYCGAVAKRQEKKGMEPLQGHATPALPFKETQELLL
  SPLPQEGPGSLAAGESSSLSASTSVSDSSQKKEEHNYSLFVSDNLGEQPTKCSPEEDEED
  EEDVDDEDHDEGFGSEHELSENEEEEEEEEDYEDDKDDDISDTFSEPGYENDSVEDLKEV
  TSISSRKRGKRRYFWEYSEQLTPSQQERMLRPSEWNRDTLPSNMYQKNGLHHGKYAVKKS
  RRTDVEDLTPNPKKLLQIGNELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASRACRL
  KKKAQYEANKVKLWGLNTEYDNLLFVINSIKQEIVNRVQNPRDERGPNMGQKLEILIKDT
  LGLPVAGQTSEFVNQVLEKTAEGNPTGGLVGLRIPTSKV
• Function: Acts as a negative regulator of the endoplasmic reticulum stress response or unfolded protein response (UPR). Represses the transcriptional activity of CREB3 during the UPR. Recruits CREB3 into nuclear foci.
• Reactome Pathway: CREB3 factors activate genes (R-HSA-8874211)

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[1]
Carcinoma	DISH9F1N	Strong	Altered Expression	[2]
Central precocious puberty	DISW1TFK	Strong	Biomarker	[3]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[1]
Chondrosarcoma	DIS4I7JB	Strong	Biomarker	[4]
Chronic kidney disease	DISW82R7	Strong	Genetic Variation	[5]
Depression	DIS3XJ69	Strong	Biomarker	[6]
Leukemia	DISNAKFL	Strong	Genetic Variation	[7]
Neoplasm	DISZKGEW	Strong	Altered Expression	[8]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[9]
Adult glioblastoma	DISVP4LU	moderate	Altered Expression	[10]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[4]
Benign prostatic hyperplasia	DISI3CW2	moderate	Altered Expression	[11]
Chronic renal failure	DISGG7K6	moderate	Genetic Variation	[12]
End-stage renal disease	DISXA7GG	moderate	Genetic Variation	[12]
Gastric cancer	DISXGOUK	moderate	Biomarker	[13]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[10]
Obesity	DIS47Y1K	moderate	Genetic Variation	[12]
Prostate cancer	DISF190Y	moderate	Altered Expression	[11]
Prostate carcinoma	DISMJPLE	moderate	Altered Expression	[11]
Stomach cancer	DISKIJSX	moderate	Biomarker	[13]
Gallbladder cancer	DISXJUAF	Disputed	Biomarker	[14]
Gallbladder carcinoma	DISD6ACL	Disputed	Altered Expression	[14]
Inherited obesity	DISVH4OT	Limited	Autosomal dominant	[15]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[16]
Precocious puberty	DISYI2XZ	Limited	Biomarker	[3]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[17]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of CREB3 regulatory factor (CREBRF).	[18]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of CREB3 regulatory factor (CREBRF).	[35]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of CREB3 regulatory factor (CREBRF).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of CREB3 regulatory factor (CREBRF).	[20]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of CREB3 regulatory factor (CREBRF).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of CREB3 regulatory factor (CREBRF).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of CREB3 regulatory factor (CREBRF).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of CREB3 regulatory factor (CREBRF).	[24]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of CREB3 regulatory factor (CREBRF).	[25]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of CREB3 regulatory factor (CREBRF).	[26]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of CREB3 regulatory factor (CREBRF).	[27]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of CREB3 regulatory factor (CREBRF).	[24]
Marinol	DM70IK5	Approved	Marinol increases the expression of CREB3 regulatory factor (CREBRF).	[28]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of CREB3 regulatory factor (CREBRF).	[29]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of CREB3 regulatory factor (CREBRF).	[30]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of CREB3 regulatory factor (CREBRF).	[31]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of CREB3 regulatory factor (CREBRF).	[32]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of CREB3 regulatory factor (CREBRF).	[33]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of CREB3 regulatory factor (CREBRF).	[34]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of CREB3 regulatory factor (CREBRF).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of CREB3 regulatory factor (CREBRF).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of CREB3 regulatory factor (CREBRF).	[38]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of CREB3 regulatory factor (CREBRF).	[29]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of CREB3 regulatory factor (CREBRF).	[39]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of CREB3 regulatory factor (CREBRF).	[40]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of CREB3 regulatory factor (CREBRF).	[41]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of CREB3 regulatory factor (CREBRF).	[42]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of CREB3 regulatory factor (CREBRF).	[43]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of CREB3 regulatory factor (CREBRF).	[44]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of CREB3 regulatory factor (CREBRF).	[45]

References

• [1] Monosomy 20 as a pointer to dicentric (9;20) in acute lymphoblastic leukemia.Leukemia. 2000 Feb;14(2):241-6. doi: 10.1038/sj.leu.2401654.
• [2] Epidermal growth factor increases LRF/Pokemon expression in human prostate cancer cells.Exp Mol Pathol. 2011 Oct;91(2):496-501. doi: 10.1016/j.yexmp.2011.05.006. Epub 2011 May 27.
• [3] Pituitary gonadotropin-independent male-limited autosomal dominant sexual precocity in nine generations: familial testotoxicosis.J Pediatr. 1985 Jan;106(1):33-40. doi: 10.1016/s0022-3476(85)80460-1.
• [4] The oncogene LRF is a survival factor in chondrosarcoma and contributes to tumor malignancy and drug resistance.Carcinogenesis. 2012 Nov;33(11):2076-83. doi: 10.1093/carcin/bgs254. Epub 2012 Jul 30.
• [5] Discordant association of the CREBRF rs373863828 A allele with increased BMI and protection from type 2 diabetes in Mori and Pacific (Polynesian) people living in Aotearoa/New Zealand.Diabetologia. 2018 Jul;61(7):1603-1613. doi: 10.1007/s00125-018-4623-1. Epub 2018 May 2.
• [6] Low-Frequency Right Repetitive Transcranial Magnetic Stimulation for the Treatment of Depression After Traumatic Brain Injury: A Randomized Sham-Controlled Pilot Study.J Neuropsychiatry Clin Neurosci. 2019 Fall;31(4):306-318. doi: 10.1176/appi.neuropsych.17110338. Epub 2019 Apr 25.
• [7] Mutational status of the TP53 gene as a predictor of response and survival in patients with chronic lymphocytic leukemia: results from the LRF CLL4 trial.J Clin Oncol. 2011 Jun 1;29(16):2223-9. doi: 10.1200/JCO.2010.32.0838. Epub 2011 Apr 11.
• [8] Intragenic antagonistic roles of protein and circRNA in tumorigenesis.Cell Res. 2019 Aug;29(8):628-640. doi: 10.1038/s41422-019-0192-1. Epub 2019 Jun 17.
• [9] The morphology of CLL revisited: the clinical significance of prolymphocytes and correlations with prognostic/molecular markers in the LRF CLL4 trial.Br J Haematol. 2016 Sep;174(5):767-75. doi: 10.1111/bjh.14132. Epub 2016 May 6.
• [10] CREBRF is a potent tumor suppressor of glioblastoma by blocking hypoxia-induced autophagy via the CREB3/ATG5 pathway.Int J Oncol. 2016 Aug;49(2):519-28. doi: 10.3892/ijo.2016.3576. Epub 2016 Jun 9.
• [11] Expression of leukemia/lymphoma related factor (LRF/Pokemon) in human benign prostate hyperplasia and prostate cancer.Exp Mol Pathol. 2011 Apr;90(2):226-30. doi: 10.1016/j.yexmp.2011.01.003. Epub 2011 Jan 18.
• [12] Association of CREBRF variants with obesity and diabetes in Pacific Islanders from Guam and Saipan.Diabetologia. 2019 Sep;62(9):1647-1652. doi: 10.1007/s00125-019-4932-z. Epub 2019 Jul 6.
• [13] CREBRF promotes the proliferation of human gastric cancer cells via the AKT signaling pathway.Cell Mol Biol (Noisy-le-grand). 2018 Apr 30;64(5):40-45.
• [14] MicroRNA-181b blocks gensenoside Rg3-mediated tumor suppression of gallbladder carcinoma by promoting autophagy flux via CREBRF/CREB3 pathway.Am J Transl Res. 2019 Sep 15;11(9):5776-5787. eCollection 2019.
• [15] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [16] The Mori and Pacific specific CREBRF variant and adult height.Int J Obes (Lond). 2020 Mar;44(3):748-752. doi: 10.1038/s41366-019-0437-6. Epub 2019 Sep 22.
• [17] The transcription factor FBI-1/OCZF/LRF is expressed in osteoclasts and regulates RANKL-induced osteoclast formation in vitro and in vivo.Arthritis Rheum. 2011 Sep;63(9):2744-54. doi: 10.1002/art.30455.
• [18] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [19] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [20] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [21] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [22] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [25] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [26] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [27] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [28] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [29] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [30] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [31] Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
• [32] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [33] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [34] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [39] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [40] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [41] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [42] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [43] Effects of nickel treatment on H3K4 trimethylation and gene expression. PLoS One. 2011 Mar 24;6(3):e17728. doi: 10.1371/journal.pone.0017728.
• [44] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [45] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.