Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1VD51B)

• DOT Name: Amyloid beta precursor protein binding family B member 2 (APBB2)
• Synonyms: Amyloid-beta (A4) precursor protein-binding family B member 2; Protein Fe65-like 1
• Gene Name: APBB2
• Related Disease:
  OPTN-related open angle glaucoma
  Alzheimer disease
  Amyloidosis
  Major depressive disorder
  Mood disorder
  Neuroblastoma
• UniProt ID: APBB2_HUMAN
• Pfam ID: PF00640 ; PF00397
• Sequence:
  MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKN
  STPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNK
  NLSPTAVINITSEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRG
  NHHGTAEEKSQPVQGQASTIIGNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDHPKTG
  AKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
  DIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQPWSDFAVLNGG
  KINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFA
  VRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLS
  LVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATS
  LHEICSKIMAERKNAKALACSSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPV
  DKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFM
  GVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVR
  PPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP
• Function: Plays a role in the maintenance of lens transparency, and may also play a role in muscle cell strength. Involved in hippocampal neurite branching and neuromuscular junction formation, as a result plays a role in spatial memory functioning. Activates transcription of APP.
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
OPTN-related open angle glaucoma	DISDR98A	Definitive	Genetic Variation	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Amyloidosis	DISHTAI2	Strong	Altered Expression	[3]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[4]
Mood disorder	DISLVMWO	Strong	Genetic Variation	[4]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[5]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Amyloid beta precursor protein binding family B member 2 (APBB2) affects the response to substance of Fluorouracil.	[28]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[6]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[7]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[8]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[9]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[10]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[11]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[12]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[13]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[14]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[15]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[16]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[17]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[18]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[19]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[20]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[21]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[22]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[24]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[25]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[26]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[13]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Amyloid beta precursor protein binding family B member 2 (APBB2).	[27]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Amyloid beta precursor protein binding family B member 2 (APBB2).	[23]

References

• [1] Association of Genetic Variants With Primary Open-Angle Glaucoma Among Individuals With African Ancestry.JAMA. 2019 Nov 5;322(17):1682-1691. doi: 10.1001/jama.2019.16161.
• [2] GSK3 Interactions with Amyloid Genes: An Autopsy Verification and Extension.Neurotox Res. 2015 Oct;28(3):232-8. doi: 10.1007/s12640-015-9541-0. Epub 2015 Jul 21.
• [3] APBB2 genetic polymorphisms are associated with severe cognitive impairment in centenarians.Exp Gerontol. 2013 Apr;48(4):391-4. doi: 10.1016/j.exger.2013.01.013. Epub 2013 Feb 4.
• [4] Analysis of 23andMe antidepressant efficacy survey data: implication of circadian rhythm and neuroplasticity in bupropion response.Transl Psychiatry. 2016 Sep 13;6(9):e889. doi: 10.1038/tp.2016.171.
• [5] The inhibition of 45A ncRNA expression reduces tumor formation, affecting tumor nodules compactness and metastatic potential in neuroblastoma cells.Oncotarget. 2017 Jan 31;8(5):8189-8205. doi: 10.18632/oncotarget.14138.
• [6] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [7] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [8] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [9] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [10] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [11] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [12] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [13] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [14] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [15] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [16] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [17] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [18] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [19] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [20] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [21] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [22] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [23] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [24] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [25] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [26] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [27] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [28] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.