Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2JFB3S)

• DOT Name: Selenoprotein F (SELENOF)
• Synonyms: 15 kDa selenoprotein
• Gene Name: SELENOF
• Related Disease:
  Colorectal carcinoma
  Non-small-cell lung cancer
  Rectal carcinoma
  Bladder cancer
  Cataract
  Colon cancer
  Colon carcinoma
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Neoplasm
  Urinary bladder cancer
  Urinary bladder neoplasm
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Mesothelioma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: SEP15_HUMAN
• Pfam ID: PF08806
• Sequence:
  MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQ
  FNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQ
  IKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI
• Function: May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum. May regulate protein folding by enhancing the catalytic activity of UGGT1/UGCGL1 and UGGT2/UGCGL2.
• Tissue Specificity: Higher levels in prostate and thyroid gland.

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Non-small-cell lung cancer	DIS5Y6R9	Definitive	Biomarker	[2]
Rectal carcinoma	DIS8FRR7	Definitive	Biomarker	[1]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[3]
Cataract	DISUD7SL	Strong	Biomarker	[4]
Colon cancer	DISVC52G	Strong	Genetic Variation	[1]
Colon carcinoma	DISJYKUO	Strong	Genetic Variation	[1]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[5]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[5]
Lung neoplasm	DISVARNB	Strong	Genetic Variation	[5]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Urinary bladder cancer	DISDV4T7	Strong	Genetic Variation	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[3]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[6]
Breast cancer	DIS7DPX1	moderate	Genetic Variation	[7]
Breast carcinoma	DIS2UE88	moderate	Genetic Variation	[7]
Mesothelioma	DISKWK9M	moderate	Altered Expression	[8]
Prostate cancer	DISF190Y	Disputed	Genetic Variation	[9]
Prostate carcinoma	DISMJPLE	Disputed	Genetic Variation	[9]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Selenium	DM25CGV	Approved	Selenoprotein F (SELENOF) decreases the response to substance of Selenium.	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Selenoprotein F (SELENOF).	[10]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Selenoprotein F (SELENOF).	[11]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Selenoprotein F (SELENOF).	[12]
Marinol	DM70IK5	Approved	Marinol increases the expression of Selenoprotein F (SELENOF).	[13]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Selenoprotein F (SELENOF).	[14]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Selenoprotein F (SELENOF).	[15]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Selenoprotein F (SELENOF).	[16]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Selenoprotein F (SELENOF).	[17]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of Selenoprotein F (SELENOF).	[18]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Selenoprotein F (SELENOF).	[19]

References

• [1] Genetic variation in selenoprotein genes, lifestyle, and risk of colon and rectal cancer.PLoS One. 2012;7(5):e37312. doi: 10.1371/journal.pone.0037312. Epub 2012 May 17.
• [2] Expression of selenoprotein-coding genes SEPP1, SEP15 and hGPX1 in non-small cell lung cancer.Lung Cancer. 2009 Jul;65(1):34-40. doi: 10.1016/j.lungcan.2008.10.023. Epub 2008 Dec 6.
• [3] Level of selenoprotein transcripts in peripheral leukocytes of patients with bladder cancer and healthy individuals.Clin Chem Lab Med. 2009;47(9):1125-32. doi: 10.1515/CCLM.2009.261.
• [4] Roles of the 15-kDa selenoprotein (Sep15) in redox homeostasis and cataract development revealed by the analysis of Sep 15 knockout mice.J Biol Chem. 2011 Sep 23;286(38):33203-12. doi: 10.1074/jbc.M111.259218. Epub 2011 Jul 18.
• [5] Lung cancer risk associated with selenium status is modified in smoking individuals by Sep15 polymorphism.Eur J Nutr. 2008 Feb;47(1):47-54. doi: 10.1007/s00394-008-0696-9. Epub 2008 Jan 31.
• [6] Role of Selenoprotein F in Protein Folding and Secretion: Potential Involvement in Human Disease.Nutrients. 2018 Nov 2;10(11):1619. doi: 10.3390/nu10111619.
• [7] The 811 C/T polymorphism in the 3' untranslated region of the selenoprotein 15-kDa (Sep15) gene and breast cancer in Caucasian women.Tumour Biol. 2016 Jan;37(1):1009-15. doi: 10.1007/s13277-015-3847-7. Epub 2015 Aug 12.
• [8] Growth inhibition and induction of apoptosis in mesothelioma cells by selenium and dependence on selenoprotein SEP15 genotype. Oncogene. 2004 Jun 24;23(29):5032-40. doi: 10.1038/sj.onc.1207683.
• [9] Variation in selenoenzyme genes and prostate cancer risk and survival.Prostate. 2013 May;73(7):734-42. doi: 10.1002/pros.22617. Epub 2012 Nov 9.
• [10] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [11] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [12] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [13] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [14] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [15] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [16] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [17] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [18] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [19] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [20] Growth inhibition and induction of apoptosis in mesothelioma cells by selenium and dependence on selenoprotein SEP15 genotype. Oncogene. 2004 Jun 24;23(29):5032-40. doi: 10.1038/sj.onc.1207683.