Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT65D3ZK)

• DOT Name: Mitochondrial enolase superfamily member 1 (ENOSF1)
• Synonyms: EC 4.2.1.68; Antisense RNA to thymidylate synthase; rTS; L-fuconate dehydratase
• Gene Name: ENOSF1
• Related Disease:
  Adult lymphoma
  Advanced cancer
  Colorectal carcinoma
  Endometrial cancer
  Endometrial carcinoma
  Epithelial ovarian cancer
  Exanthem
  Glioma
  Herpes zoster
  Intellectual disability
  leukaemia
  Leukemia
  Lymphoma
  Malaria
  Meningitis
  Neoplasm
  Ovarian cancer
  Pediatric lymphoma
  Plasmodium falciparum malaria
  Poikiloderma with neutropenia
  Premature aging syndrome
  Rabies
  Rothmund-Thomson syndrome
  Rubinstein-Taybi syndrome
  Sleep apnea syndrome
  Filippi syndrome
  Gastric cancer
  Juvenile hyaline fibromatosis
  Stomach cancer
  Werner syndrome
  Cutaneous mastocytosis
• UniProt ID: ENOF1_HUMAN
• PDB ID: 4A35
• EC Number: 4.2.1.68
• Pfam ID: PF13378 ; PF02746
• Sequence:
  MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGK
  GTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLN
  AVWDLWAKQEGKPVWKLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREK
  QMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDMRRCQIIRDM
  IGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVPLGIG
  IATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVG
  LCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKE
  ESVKKHQYPDGEVWKKLLPAQEN
• Function: Plays a role in the catabolism of L-fucose, a sugar that is part of the carbohydrates that are attached to cellular glycoproteins. Catalyzes the dehydration of L-fuconate to 2-keto-3-deoxy-L-fuconate by the abstraction of the 2-proton to generate an enediolate intermediate that is stabilized by the magnesium ion.
• KEGG Pathway:
  Fructose and mannose metabolism (hsa00051)
  Metabolic pathways (hsa01100)

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult lymphoma	DISK8IZR	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[3]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[4]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[4]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[5]
Exanthem	DISAFOQN	Strong	Genetic Variation	[6]
Glioma	DIS5RPEH	Strong	Biomarker	[7]
Herpes zoster	DISNSMNY	Strong	Biomarker	[8]
Intellectual disability	DISMBNXP	Strong	Biomarker	[1]
leukaemia	DISS7D1V	Strong	Biomarker	[9]
Leukemia	DISNAKFL	Strong	Biomarker	[9]
Lymphoma	DISN6V4S	Strong	Biomarker	[1]
Malaria	DISQ9Y50	Strong	Biomarker	[10]
Meningitis	DISQABAA	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[5]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[5]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[1]
Plasmodium falciparum malaria	DIS3Q9KF	Strong	Biomarker	[12]
Poikiloderma with neutropenia	DIS20E3L	Strong	Biomarker	[13]
Premature aging syndrome	DIS51AGT	Strong	Biomarker	[2]
Rabies	DISSC4V5	Strong	Biomarker	[14]
Rothmund-Thomson syndrome	DISGVBCV	Strong	Genetic Variation	[15]
Rubinstein-Taybi syndrome	DISVF1HM	Strong	Genetic Variation	[16]
Sleep apnea syndrome	DISER6KS	Strong	Biomarker	[17]
Filippi syndrome	DISFTDQH	moderate	Biomarker	[16]
Gastric cancer	DISXGOUK	moderate	Genetic Variation	[18]
Juvenile hyaline fibromatosis	DISQP8V9	moderate	Genetic Variation	[19]
Stomach cancer	DISKIJSX	moderate	Genetic Variation	[18]
Werner syndrome	DISZY45W	moderate	Biomarker	[20]
Cutaneous mastocytosis	DISLBZEF	Limited	Biomarker	[11]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Mitochondrial enolase superfamily member 1 (ENOSF1) affects the response to substance of Methotrexate.	[36]
Fluorouracil	DMUM7HZ	Approved	Mitochondrial enolase superfamily member 1 (ENOSF1) decreases the response to substance of Fluorouracil.	[34]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[21]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[22]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[23]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[25]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[26]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[27]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[28]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[29]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[30]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[26]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[26]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[33]
MANUMYCIN A	DM1SWOY	Terminated	MANUMYCIN A decreases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[34]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Mitochondrial enolase superfamily member 1 (ENOSF1).	[35]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Mitochondrial enolase superfamily member 1 (ENOSF1).	[32]

References

• [1] Rothmund-Thomson syndrome and osteoma cutis in a patient previously diagnosed as COPS syndrome.Eur J Pediatr. 2017 Feb;176(2):279-283. doi: 10.1007/s00431-016-2834-3. Epub 2016 Dec 30.
• [2] RecQL4 helicase amplification is involved in human breast tumorigenesis.PLoS One. 2013 Jul 22;8(7):e69600. doi: 10.1371/journal.pone.0069600. Print 2013.
• [3] A candidate gene study of capecitabine-related toxicity in colorectal cancer identifies new toxicity variants at DPYD and a putative role for ENOSF1 rather than TYMS.Gut. 2015 Jan;64(1):111-20. doi: 10.1136/gutjnl-2013-306571. Epub 2014 Mar 19.
• [4] Association of thymidylate synthase gene with endometrial cancer risk in a Chinese population.Cancer Epidemiol Biomarkers Prev. 2009 Feb;18(2):579-84. doi: 10.1158/1055-9965.EPI-08-0831. Epub 2009 Feb 3.
• [5] rs495139 in the TYMS-ENOSF1 Region and Risk of Ovarian Carcinoma of Mucinous Histology.Int J Mol Sci. 2018 Aug 21;19(9):2473. doi: 10.3390/ijms19092473.
• [6] Defective sister-chromatid cohesion, aneuploidy and cancer predisposition in a mouse model of type II Rothmund-Thomson syndrome.Hum Mol Genet. 2005 Mar 15;14(6):813-25. doi: 10.1093/hmg/ddi075. Epub 2005 Feb 9.
• [7] Regulated intratumoral expression of IL-12 using a RheoSwitch Therapeutic System() (RTS()) gene switch as gene therapy for the treatment of glioma.Cancer Gene Ther. 2018 Jun;25(5-6):106-116. doi: 10.1038/s41417-018-0019-0. Epub 2018 May 14.
• [8] Updated insights into the mechanism of action and clinical profile of the immunoadjuvant QS-21: A review.Phytomedicine. 2019 Jul;60:152905. doi: 10.1016/j.phymed.2019.152905. Epub 2019 Mar 30.
• [9] Realgar transforming solution as a novel arsenic agent with a lower risk of cardiotoxicity.J Pharmacol Sci. 2019 Jun;140(2):162-170. doi: 10.1016/j.jphs.2019.06.003. Epub 2019 Jun 15.
• [10] Combining antimalarial drugs and vaccine for malaria elimination campaigns: a randomized safety and immunogenicity trial of RTS,S/AS01 administered with dihydroartemisinin, piperaquine, and primaquine in healthy Thai adult volunteers.Hum Vaccin Immunother. 2020;16(1):33-41. doi: 10.1080/21645515.2019.1643675. Epub 2019 Aug 15.
• [11] Safety profile of the RTS,S/AS01 malaria vaccine in infants and children: additional data from a phase III randomized controlled trial in sub-Saharan Africa.Hum Vaccin Immunother. 2019;15(10):2386-2398. doi: 10.1080/21645515.2019.1586040. Epub 2019 Apr 23.
• [12] Immune response to the hepatitis B antigen in the RTS,S/AS01 malaria vaccine, and co-administration with pneumococcal conjugate and rotavirus vaccines in African children: A randomized controlled trial.Hum Vaccin Immunother. 2018 Jun 3;14(6):1489-1500. doi: 10.1080/21645515.2018.1442996. Epub 2018 Apr 13.
• [13] Mutations in C16orf57 and normal-length telomeres unify a subset of patients with dyskeratosis congenita, poikiloderma with neutropenia and Rothmund-Thomson syndrome. Hum Mol Genet. 2010 Nov 15;19(22):4453-61. doi: 10.1093/hmg/ddq371. Epub 2010 Sep 3.
• [14] Safety and immunogenicity of the RTS,S/AS01 malaria vaccine in infants and children identified as HIV-infected during a randomized trial in sub-Saharan Africa.Vaccine. 2020 Jan 22;38(4):897-906. doi: 10.1016/j.vaccine.2019.10.077. Epub 2019 Nov 7.
• [15] Targeted next-generation sequencing appoints c16orf57 as clericuzio-type poikiloderma with neutropenia gene. Am J Hum Genet. 2010 Jan;86(1):72-6. doi: 10.1016/j.ajhg.2009.11.014. Epub 2009 Dec 10.
• [16] Mosaic CREBBP mutation causes overlapping clinical features of Rubinstein-Taybi and Filippi syndromes.Eur J Hum Genet. 2016 Aug;24(9):1363-6. doi: 10.1038/ejhg.2016.14. Epub 2016 Mar 9.
• [17] Retinal vein occlusion and obstructive sleep apnea: a series of 114 patients.Acta Ophthalmol. 2018 Dec;96(8):e919-e925. doi: 10.1111/aos.13798. Epub 2018 Sep 6.
• [18] Pharmacogenetic variants associated with outcome in patients with advanced gastric cancer treated with fluoropyrimidine and platinum-based triplet combinations: a pooled analysis of three prospective studies.Pharmacogenomics J. 2017 Oct;17(5):441-451. doi: 10.1038/tpj.2016.81. Epub 2016 Dec 20.
• [19] Evaluating the role of ENOSF1 and TYMS variants as predictors in fluoropyrimidine-related toxicities: An IPD meta-analysis.Pharmacol Res. 2020 Feb;152:104594. doi: 10.1016/j.phrs.2019.104594. Epub 2019 Dec 12.
• [20] Role of the Bloom's syndrome helicase in maintenance of genome stability.Biochem Soc Trans. 2001 May;29(Pt 2):201-4. doi: 10.1042/0300-5127:0290201.
• [21] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [22] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [23] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [24] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [25] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [26] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [27] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [28] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [29] Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
• [30] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [31] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [32] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [33] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [34] Expression of rTSbeta as a 5-fluorouracil resistance marker in patients with primary breast cancer. Oncol Rep. 2008 Apr;19(4):881-8.
• [35] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [36] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [37] Expression of rTSbeta as a 5-fluorouracil resistance marker in patients with primary breast cancer. Oncol Rep. 2008 Apr;19(4):881-8.