Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7CODJ4)

• DOT Name: Signal transducer CD24 (CD24)
• Synonyms: Small cell lung carcinoma cluster 4 antigen; CD antigen CD24
• Gene Name: CD24
• UniProt ID: CD24_HUMAN
• Pfam ID: PF14984
• Sequence:
  MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
  ALQSTASLFVVSLSLLHLYS
• Function: May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90. Plays a role in the control of autoimmunity.
• Tissue Specificity: B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.
• KEGG Pathway:
  Efferocytosis (hsa04148)
  Hematopoietic cell lineage (hsa04640)
• Reactome Pathway: L1CAM interactions (R-HSA-373760)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Signal transducer CD24 (CD24) affects the response to substance of Topotecan.	[30]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Signal transducer CD24 (CD24).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Signal transducer CD24 (CD24).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Signal transducer CD24 (CD24).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Signal transducer CD24 (CD24).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Signal transducer CD24 (CD24).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Signal transducer CD24 (CD24).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Signal transducer CD24 (CD24).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Signal transducer CD24 (CD24).	[8]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Signal transducer CD24 (CD24).	[8]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Signal transducer CD24 (CD24).	[9]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Signal transducer CD24 (CD24).	[10]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Signal transducer CD24 (CD24).	[11]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Signal transducer CD24 (CD24).	[12]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Signal transducer CD24 (CD24).	[13]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Signal transducer CD24 (CD24).	[14]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Signal transducer CD24 (CD24).	[15]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Signal transducer CD24 (CD24).	[1]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Signal transducer CD24 (CD24).	[5]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Signal transducer CD24 (CD24).	[16]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Signal transducer CD24 (CD24).	[17]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Signal transducer CD24 (CD24).	[1]
Napabucasin	DMDZ6Q3	Phase 3	Napabucasin decreases the expression of Signal transducer CD24 (CD24).	[18]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Signal transducer CD24 (CD24).	[1]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Signal transducer CD24 (CD24).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Signal transducer CD24 (CD24).	[20]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Signal transducer CD24 (CD24).	[21]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Signal transducer CD24 (CD24).	[22]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Signal transducer CD24 (CD24).	[23]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Signal transducer CD24 (CD24).	[24]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Signal transducer CD24 (CD24).	[25]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Signal transducer CD24 (CD24).	[26]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Signal transducer CD24 (CD24).	[27]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Signal transducer CD24 (CD24).	[28]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of Signal transducer CD24 (CD24).	[29]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Signal transducer CD24 (CD24).	[19]

References

• [1] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Comparative gene expression profiling reveals partially overlapping but distinct genomic actions of different antiestrogens in human breast cancer cells. J Cell Biochem. 2006 Aug 1;98(5):1163-84.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Arsenic promotes the COX2/PGE2-SOX2 axis to increase the malignant stemness properties of urothelial cells. Int J Cancer. 2018 Jul 1;143(1):113-126.
• [8] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [9] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [10] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [11] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [12] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [13] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [14] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [15] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [16] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [17] In-vivo effects of simvastatin and rosuvastatin on global gene expression in peripheral blood leucocytes in a human inflammation model. Pharmacogenet Genomics. 2008 Feb;18(2):109-20.
• [18] Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
• [19] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [20] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [21] Eugenol restricts Cancer Stem Cell population by degradation of -catenin via N-terminal Ser37 phosphorylation-an in vivo and in vitro experimental evaluation. Chem Biol Interact. 2020 Jan 25;316:108938. doi: 10.1016/j.cbi.2020.108938. Epub 2020 Jan 8.
• [22] Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
• [23] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [24] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [25] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [26] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [27] Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.
• [28] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [29] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [30] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.