Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7ZYFQ9)

DOT Name Gastrokine-1 (GKN1)
Synonyms 18 kDa antrum mucosa protein; AMP-18; Protein CA11
Gene Name GKN1
Related Disease
Gastric neoplasm ( )
Adenocarcinoma ( )
Adenoma ( )
Adult glioblastoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Barrett esophagus ( )
Carcinoma ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Glioblastoma multiforme ( )
Gonorrhea ( )
Hepatocellular carcinoma ( )
Hereditary diffuse gastric adenocarcinoma ( )
Lung adenocarcinoma ( )
Pediatric lymphoma ( )
Small-cell lung cancer ( )
Stomach cancer ( )
Choriocarcinoma ( )
Hydatidiform mole ( )
Lung cancer ( )
Lung carcinoma ( )
Gastric cancer ( )
Gastritis ( )
UniProt ID
GKN1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF04089
Sequence
MKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSW
NSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLM
YSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCG
DTVEN
Function Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
Tissue Specificity Expressed in stomach (at protein level). No expression is detected in cancer tissue or gastric cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Gastric neoplasm DISOKN4Y Definitive Altered Expression [1]
Adenocarcinoma DIS3IHTY Strong Altered Expression [2]
Adenoma DIS78ZEV Strong Altered Expression [3]
Adult glioblastoma DISVP4LU Strong Biomarker [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Alzheimer disease DISF8S70 Strong Biomarker [6]
Barrett esophagus DIS416Y7 Strong Biomarker [7]
Carcinoma DISH9F1N Strong Genetic Variation [3]
Endometrial cancer DISW0LMR Strong Biomarker [8]
Endometrial carcinoma DISXR5CY Strong Biomarker [8]
Glioblastoma multiforme DISK8246 Strong Biomarker [4]
Gonorrhea DISQ5AO6 Strong Biomarker [1]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [9]
Hereditary diffuse gastric adenocarcinoma DISUIBYS Strong Biomarker [10]
Lung adenocarcinoma DISD51WR Strong Biomarker [11]
Pediatric lymphoma DIS51BK2 Strong Biomarker [12]
Small-cell lung cancer DISK3LZD Strong Altered Expression [11]
Stomach cancer DISKIJSX Strong Biomarker [13]
Choriocarcinoma DISDBVNL moderate Altered Expression [14]
Hydatidiform mole DISKNP7O moderate Biomarker [14]
Lung cancer DISCM4YA moderate Genetic Variation [15]
Lung carcinoma DISTR26C moderate Genetic Variation [15]
Gastric cancer DISXGOUK Limited Biomarker [13]
Gastritis DIS8G07K Limited Altered Expression [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 24 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Gastrokine-1 (GKN1). [17]
Aspirin DM672AH Approved Aspirin affects the expression of Gastrokine-1 (GKN1). [18]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Gastrokine-1 (GKN1). [19]
------------------------------------------------------------------------------------

References

1 GKN1 expression in gastric cancer cells is negatively regulated by miR-544a.Biochimie. 2019 Dec;167:42-48. doi: 10.1016/j.biochi.2019.09.005. Epub 2019 Sep 8.
2 Decreased expression of gastrokine 1 and the trefoil factor interacting protein TFIZ1/GKN2 in gastric cancer: influence of tumor histology and relationship to prognosis.Clin Cancer Res. 2008 Jul 1;14(13):4161-7. doi: 10.1158/1078-0432.CCR-07-4381.
3 Inactivation of the Gastrokine 1 gene in gastric adenomas and carcinomas.J Pathol. 2011 Apr;223(5):618-25. doi: 10.1002/path.2838. Epub 2011 Feb 21.
4 Experimental therapy of allogeneic solid tumors induced in athymic mice with suicide gene-transducing replication-competent foamy virus vectors.Cancer Gene Ther. 2005 Dec;12(12):947-53. doi: 10.1038/sj.cgt.7700855.
5 Regulation of GKN1 expression in gastric carcinogenesis: A problem to resolve (Review).Int J Oncol. 2019 Sep;55(3):555-569. doi: 10.3892/ijo.2019.4843. Epub 2019 Jul 16.
6 Role of human GKN1 on APP processing in gastric cancer.Biochimie. 2017 Apr;135:149-153. doi: 10.1016/j.biochi.2017.02.007. Epub 2017 Feb 16.
7 Gastrokine 1 is abundantly and specifically expressed in superficial gastric epithelium, down-regulated in gastric carcinoma, and shows high evolutionary conservation.J Pathol. 2004 Jul;203(3):789-97. doi: 10.1002/path.1583.
8 Evaluating Myometrial Invasion in Endometrial Cancer: Comparison of Reduced Field-of-view Diffusion-weighted Imaging and Dynamic Contrast-enhanced MR Imaging.Magn Reson Med Sci. 2018 Jan 10;17(1):28-34. doi: 10.2463/mrms.mp.2016-0128. Epub 2017 May 18.
9 Gastrokine 1 protein is a potential theragnostic target for gastric cancer.Gastric Cancer. 2018 Nov;21(6):956-967. doi: 10.1007/s10120-018-0828-8. Epub 2018 Apr 27.
10 Diverse proteomic alterations in gastric adenocarcinoma.Proteomics. 2004 Oct;4(10):3276-87. doi: 10.1002/pmic.200300916.
11 Variations of chromosome 2 gene expressions among patients with lung cancer or non-cancer.Cell Biol Toxicol. 2016 Oct;32(5):419-35. doi: 10.1007/s10565-016-9343-z. Epub 2016 Jun 15.
12 Is True Whole-Body (18)F-FDG PET/CT Required in Pediatric Lymphoma? An IAEA Multicenter Prospective Study.J Nucl Med. 2019 Aug;60(8):1087-1093. doi: 10.2967/jnumed.118.222299. Epub 2019 Jan 25.
13 The role and diagnostic potential of gastrokine 1 in gastric cancer.Cancer Manag Res. 2019 Mar 1;11:1921-1931. doi: 10.2147/CMAR.S194949. eCollection 2019.
14 The tumor suppressor gastrokine-1 is expressed in placenta and contributes to the regulation of trophoblast migration.Placenta. 2013 Nov;34(11):1027-35. doi: 10.1016/j.placenta.2013.08.005. Epub 2013 Aug 28.
15 Polymorphisms in C-reactive protein and Glypican-5 are associated with lung cancer risk and Gartrokine-1 influences Cisplatin-based chemotherapy response in a Chinese Han population.Dis Markers. 2015;2015:824304. doi: 10.1155/2015/824304. Epub 2015 Apr 27.
16 Helicobacter pylori inhibits GKN1 expression via the CagA/p-ERK/AUF1 pathway.Helicobacter. 2020 Feb;25(1):e12665. doi: 10.1111/hel.12665. Epub 2019 Oct 27.
17 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
18 Low-dose aspirin reduces the gene expression of gastrokine-1 in the antral mucosa of healthy subjects. Aliment Pharmacol Ther. 2008 Sep 15;28(6):782-8. doi: 10.1111/j.1365-2036.2008.03793.x.
19 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.