Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT88C8JA)

• DOT Name: Sodium- and chloride-dependent creatine transporter 1 (SLC6A8)
• Synonyms: CT1; Creatine transporter 1; Solute carrier family 6 member 8
• Gene Name: SLC6A8
• Related Disease: Creatine transporter deficiency
• UniProt ID: SC6A8_HUMAN
• Pfam ID: PF00209
• Sequence:
  MAKKSAENGIYSVSGDEKKGPLIAPGPDGAPAKGDGPVGLGTPGGRLAVPPRETWTRQMD
  FIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGS
  INVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPD
  CVEIFRHEDCANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLL
  ACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIYYLKPDWSKL
  GSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVF
  SILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFV
  GVEGFITGLLDLLPASYYFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASG
  TTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVV
  YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWG
  LHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM
• Function: Creatine:sodium symporter which mediates the uptake of creatine. Plays an important role in supplying creatine to the brain via the blood-brain barrier.
• Tissue Specificity: Predominantly expressed in skeletal muscle and kidney. Also found in brain, heart, colon, testis and prostate.
• Reactome Pathway: Creatine metabolism (R-HSA-71288)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Creatine transporter deficiency	DIS8FWNV	Definitive	X-linked	[1]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[20]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[23]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[7]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[10]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[12]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[13]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[14]
Selenium	DM25CGV	Approved	Selenium increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[15]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[11]
Zidovudine	DM4KI7O	Approved	Zidovudine decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[16]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[8]
Atenolol	DMNKG1Z	Approved	Atenolol decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[17]
Ammonia	DMOEVK6	Approved	Ammonia affects the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[18]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[19]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[11]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[15]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[21]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[22]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[24]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[25]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[26]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Sodium- and chloride-dependent creatine transporter 1 (SLC6A8).	[27]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [10] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [11] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [14] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [15] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [16] Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
• [17] Change in mRNA Expression after Atenolol, a Beta-adrenergic Receptor Antagonist and Association with Pharmacological Response. Arch Drug Inf. 2009 Sep;2(3):41-50. doi: 10.1111/j.1753-5174.2009.00020.x.
• [18] Ammonia toxicity to the brain: effects on creatine metabolism and transport and protective roles of creatine. Mol Genet Metab. 2010;100 Suppl 1:S53-8. doi: 10.1016/j.ymgme.2010.02.011. Epub 2010 Feb 14.
• [19] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [20] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [21] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [22] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [23] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [24] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [25] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [26] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [27] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.