Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9KIVZW)

• DOT Name: Oxidative stress-induced growth inhibitor 1 (OSGIN1)
• Synonyms: Bone marrow stromal cell-derived growth inhibitor; BMSC-derived growth inhibitor; Ovary, kidney and liver protein 38; huOKL38; Pregnancy-induced growth inhibitor OKL38
• Gene Name: OSGIN1
• Related Disease:
  Advanced cancer
  Arteriosclerosis
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Hepatocellular carcinoma
  Kidney cancer
  Kidney neoplasm
  Myocardial infarction
  Nasopharyngeal carcinoma
  Neoplasm
  Renal carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  AIDS-related lymphoma
• UniProt ID: OSGI1_HUMAN
• Sequence:
  MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKLTEA
  PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHV
  VLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYR
  DYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWAR
  NVVLATGTFDSPARLGIPGEALPFIHHELSALEAATRVGAVTPASDPVLIIGAGLSAADA
  VLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPSPYEGYRS
  LPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPGAGADFAVDPDQPL
  SAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP
• Function: Regulates the differentiation and proliferation through the regulation of cell death.
• Tissue Specificity: Ubiquitous. Highest expression in the ovary, testis, kidney, skeletal muscle and liver . Weakly expressed in spleen, heart, kidney, and pancreas . Highly expressed in tumor cells (at protein level) .

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[2]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[4]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[5]
Kidney cancer	DISBIPKM	Strong	Biomarker	[1]
Kidney neoplasm	DISBNZTN	Strong	Altered Expression	[6]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[7]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Genetic Variation	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Renal carcinoma	DISER9XT	Strong	Biomarker	[1]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Biomarker	[6]
Liver cancer	DISDE4BI	moderate	Biomarker	[6]
AIDS-related lymphoma	DISSLRAU	Limited	Biomarker	[9]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[10]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[11]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[12]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[10]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[14]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[15]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[16]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[17]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[18]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[18]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[10]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[17]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[19]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[10]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[20]
Cidofovir	DMA13GD	Approved	Cidofovir affects the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[10]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[10]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[10]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[3]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[22]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[23]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[25]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[27]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[28]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[29]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[30]
Bilirubin	DMI0V4O	Investigative	Bilirubin increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[31]
Lead acetate	DML0GZ2	Investigative	Lead acetate increases the expression of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[32]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Oxidative stress-induced growth inhibitor 1 (OSGIN1).	[24]

References

• [1] Genomic structure of human OKL38 gene and its differential expression in kidney carcinogenesis.J Biol Chem. 2004 Jan 2;279(1):743-54. doi: 10.1074/jbc.M308668200. Epub 2003 Oct 21.
• [2] Fatty acid epoxyisoprostane E2 stimulates an oxidative stress response in endothelial cells.Biochem Biophys Res Commun. 2014 Jan 31;444(1):69-74. doi: 10.1016/j.bbrc.2014.01.016. Epub 2014 Jan 14.
• [3] Docosahexaenoic acid increases the expression of oxidative stress-induced growth inhibitor 1 through the PI3K/Akt/Nrf2 signaling pathway in breast cancer cells. Food Chem Toxicol. 2017 Oct;108(Pt A):276-288. doi: 10.1016/j.fct.2017.08.010. Epub 2017 Aug 12.
• [4] Bone marrow stromal cell-derived growth inhibitor inhibits growth and migration of breast cancer cells via induction of cell cycle arrest and apoptosis.J Biol Chem. 2005 Feb 11;280(6):4374-82. doi: 10.1074/jbc.M408708200. Epub 2004 Nov 29.
• [5] Allele-specific imbalance of oxidative stress-induced growth inhibitor 1 associates with progression of hepatocellular carcinoma.Gastroenterology. 2014 Apr;146(4):1084-96. doi: 10.1053/j.gastro.2013.12.041. Epub 2014 Jan 11.
• [6] The role of 5' untranslated region in translational suppression of OKL38 mRNA in hepatocellular carcinoma.Oncogene. 2007 Feb 22;26(8):1155-65. doi: 10.1038/sj.onc.1209896. Epub 2006 Aug 21.
• [7] Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.Atherosclerosis. 2011 Mar;215(1):145-52. doi: 10.1016/j.atherosclerosis.2010.12.005. Epub 2010 Dec 15.
• [8] The principal genetic determinants for nasopharyngeal carcinoma in China involve the HLA class I antigen recognition groove.PLoS Genet. 2012;8(11):e1003103. doi: 10.1371/journal.pgen.1003103. Epub 2012 Nov 29.
• [9] Genomic analysis of xCT-mediated regulatory network: Identification of novel targets against AIDS-associated lymphoma.Oncotarget. 2015 May 20;6(14):12710-22. doi: 10.18632/oncotarget.3710.
• [10] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [11] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [12] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [13] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [14] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [15] LncRNA UCA1 attenuates autophagy-dependent cell death through blocking autophagic flux under arsenic stress. Toxicol Lett. 2018 Mar 1;284:195-204. doi: 10.1016/j.toxlet.2017.12.009. Epub 2017 Dec 15.
• [16] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [17] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [18] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [19] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [20] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [21] Docosahexaenoic acid increases the expression of oxidative stress-induced growth inhibitor 1 through the PI3K/Akt/Nrf2 signaling pathway in breast cancer cells. Food Chem Toxicol. 2017 Oct;108(Pt A):276-288. doi: 10.1016/j.fct.2017.08.010. Epub 2017 Aug 12.
• [22] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [23] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [24] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [25] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [28] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [29] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [30] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [31] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [32] In vitro effects of lead on gene expression in neural stem cells and associations between up-regulated genes and cognitive scores in children. Environ Health Perspect. 2017 Apr;125(4):721-729.