Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB7OF7Y)

DOT Name Uridylate-specific endoribonuclease (ENDOU)
Synonyms EC 4.6.1.-; Placental protein 11; PP11; Protein endoU
Gene Name ENDOU
Related Disease
Parkinson disease ( )
Acute lymphocytic leukaemia ( )
Alzheimer disease ( )
Childhood acute lymphoblastic leukemia ( )
Depression ( )
Hematologic disease ( )
Hereditary neuropathy with liability to pressure palsies ( )
Hydrocephalus ( )
Irritable bowel syndrome ( )
Malignant soft tissue neoplasm ( )
Neuroblastoma ( )
Post-traumatic stress disorder ( )
Sarcoma ( )
Smith-Magenis syndrome ( )
Thyroid gland carcinoma ( )
Adrenoleukodystrophy ( )
Neoplasm ( )
Advanced cancer ( )
Anxiety ( )
Anxiety disorder ( )
Mental disorder ( )
Schizophrenia ( )
UniProt ID
ENDOU_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
4.6.1.-
Pfam ID
PF01033 ; PF09412
Sequence
MRACISLVLAVLCGLAWAGKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTE
DHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDF
ESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDR
CPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVM
KELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFH
NWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFAL
YSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST
Function
Endoribonuclease that cleaves single-stranded RNAs at 5' of uridylates and releases a product with a 2',3'-cyclic phosphate at the 3'-end. The UU and GU sites are more efficiently cleaved than CU and AU sites.
Tissue Specificity Placental-specific, but also associated with various malignant neoplasms.

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Parkinson disease DISQVHKL Definitive Altered Expression [1]
Acute lymphocytic leukaemia DISPX75S Strong Altered Expression [2]
Alzheimer disease DISF8S70 Strong Genetic Variation [3]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Altered Expression [2]
Depression DIS3XJ69 Strong Biomarker [4]
Hematologic disease DIS9XD9A Strong Altered Expression [5]
Hereditary neuropathy with liability to pressure palsies DISY0X1V Strong Biomarker [6]
Hydrocephalus DISIZUF7 Strong Genetic Variation [7]
Irritable bowel syndrome DIS27206 Strong Altered Expression [8]
Malignant soft tissue neoplasm DISTC6NO Strong Genetic Variation [9]
Neuroblastoma DISVZBI4 Strong Genetic Variation [3]
Post-traumatic stress disorder DISHL1EY Strong Altered Expression [10]
Sarcoma DISZDG3U Strong Genetic Variation [9]
Smith-Magenis syndrome DISG4G6X Strong Biomarker [6]
Thyroid gland carcinoma DISMNGZ0 Strong Biomarker [11]
Adrenoleukodystrophy DISTUD1F moderate Altered Expression [12]
Neoplasm DISZKGEW moderate Biomarker [11]
Advanced cancer DISAT1Z9 Limited Biomarker [13]
Anxiety DISIJDBA Limited Biomarker [14]
Anxiety disorder DISBI2BT Limited Biomarker [14]
Mental disorder DIS3J5R8 Limited Biomarker [10]
Schizophrenia DISSRV2N Limited Altered Expression [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 22 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Uridylate-specific endoribonuclease (ENDOU). [16]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Uridylate-specific endoribonuclease (ENDOU). [19]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Uridylate-specific endoribonuclease (ENDOU). [17]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Uridylate-specific endoribonuclease (ENDOU). [18]
------------------------------------------------------------------------------------

References

1 Alterations of p11 in brain tissue and peripheral blood leukocytes in Parkinson's disease.Proc Natl Acad Sci U S A. 2017 Mar 7;114(10):2735-2740. doi: 10.1073/pnas.1621218114. Epub 2017 Jan 30.
2 Disruption of Annexin II /p11 Interaction Suppresses Leukemia Cell Binding, Homing and Engraftment, and Sensitizes the Leukemia Cells to Chemotherapy.PLoS One. 2015 Oct 14;10(10):e0140564. doi: 10.1371/journal.pone.0140564. eCollection 2015.
3 5-HT1B and other related serotonergic proteins are altered in APPswe mutation. Neurosci Lett. 2015 May 6;594:137-43.
4 IGF-II-Conjugated Nanocarrier for Brain-Targeted Delivery of p11 Gene for Depression.AAPS PharmSciTech. 2019 Jan 7;20(2):50. doi: 10.1208/s12249-018-1206-x.
5 Chromosome 12 rearrangement with breakage at the p11 level in hematologic disorders: report of four cases.Cancer Genet Cytogenet. 1985 Feb 15;15(3-4):309-14. doi: 10.1016/0165-4608(85)90175-x.
6 Microsatellite mapping of the deletion in patients with hereditary neuropathy with liability to pressure palsies (HNPP): new molecular tools for the study of the region 17p12 --> p11 and for diagnosis.Cytogenet Cell Genet. 1996;72(1):20-5. doi: 10.1159/000134153.
7 Impaired neural differentiation and glymphatic CSF flow in the Ccdc39 rat model of neonatal hydrocephalus: genetic interaction with L1cam.Dis Model Mech. 2019 Nov 21;12(11):dmm040972. doi: 10.1242/dmm.040972.
8 Alterations in expression of p11 and SERT in mucosal biopsy specimens of patients with irritable bowel syndrome.Gastroenterology. 2007 Jan;132(1):17-25. doi: 10.1053/j.gastro.2006.11.020. Epub 2006 Nov 17.
9 Loss of TP53 in sarcomas with 17p12 to approximately p11 gain. A fine-resolution oligonucleotide array comparative genomic hybridization study.Cytogenet Genome Res. 2007;116(3):153-7. doi: 10.1159/000098180.
10 P11 (S100A10) as a potential biomarker of psychiatric patients at risk of suicide.J Psychiatr Res. 2011 Apr;45(4):435-41. doi: 10.1016/j.jpsychires.2010.08.012. Epub 2010 Sep 22.
11 Peptide P11 suppresses the growth of human thyroid carcinoma by inhibiting the PI3K/AKT/mTOR signaling pathway.Mol Biol Rep. 2019 Jun;46(3):2665-2678. doi: 10.1007/s11033-019-04698-7. Epub 2019 Apr 26.
12 Direct effects of alcohol on hepatic fibrinolytic balance: implications for alcoholic liver disease.J Hepatol. 2008 Apr;48(4):614-27. doi: 10.1016/j.jhep.2007.12.015. Epub 2008 Jan 29.
13 Selective inhibitor of platelet-activating factor acetylhydrolases 1b2 and 1b3 that impairs cancer cell survival.ACS Chem Biol. 2015 Apr 17;10(4):925-32. doi: 10.1021/cb500893q. Epub 2015 Jan 20.
14 P11 Loss-of-Function is Associated with Decreased Cell Proliferation and Neurobehavioral Disorders in Mice.Int J Biol Sci. 2019 May 20;15(7):1383-1395. doi: 10.7150/ijbs.33773. eCollection 2019.
15 Levels of the potential biomarker p11 in peripheral blood cells distinguish patients with PTSD from those with other major psychiatric disorders.J Psychiatr Res. 2009 Sep;43(13):1078-85. doi: 10.1016/j.jpsychires.2009.03.010. Epub 2009 Apr 19.
16 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
18 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
19 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.