Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCOSEVH)

• DOT Name: DnaJ homolog subfamily B member 1 (DNAJB1)
• Synonyms: DnaJ protein homolog 1; Heat shock 40 kDa protein 1; HSP40; Heat shock protein 40; Human DnaJ protein 1; hDj-1
• Gene Name: DNAJB1
• UniProt ID: DNJB1_HUMAN
• PDB ID: 1HDJ; 2QLD; 3AGX; 3AGY; 3AGZ; 4WB7; 6BYR; 6WJF; 6WJG; 6Z5N; 7NDX; 8FE2; 8FE5; 8FEC
• Pfam ID: PF00226 ; PF01556
• Sequence:
  MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
  REIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
  GEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCT
  KKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLK
  DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
  GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
• Function: Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro).
• KEGG Pathway:
  Protein processing in endoplasmic reticulum (hsa04141)
  Influenza A (hsa05164)
• Reactome Pathway:
  HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand (R-HSA-3371497)
  Attenuation phase (R-HSA-3371568)
  HSF1-dependent transactivation (R-HSA-3371571)
  MAPK6/MAPK4 signaling (R-HSA-5687128)
  Regulation of HSF1-mediated heat shock response (R-HSA-3371453)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	DnaJ homolog subfamily B member 1 (DNAJB1) decreases the response to substance of Hydrogen peroxide.	[39]
Paraquat	DMR8O3X	Investigative	DnaJ homolog subfamily B member 1 (DNAJB1) decreases the response to substance of Paraquat.	[39]

42 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[2]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[8]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[11]
Marinol	DM70IK5	Approved	Marinol decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[12]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[13]
Menadione	DMSJDTY	Approved	Menadione affects the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[14]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[15]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[16]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[17]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[11]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[18]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[19]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[20]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[21]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[20]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[23]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[24]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl affects the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[25]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[19]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[27]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide affects the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[28]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[29]
EMODIN	DMAEDQG	Terminated	EMODIN increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[30]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[31]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[26]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[32]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[33]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[34]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[35]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[36]
Bilirubin	DMI0V4O	Investigative	Bilirubin affects the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[37]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of DnaJ homolog subfamily B member 1 (DNAJB1).	[38]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Gefitinib	DM15F0X	Approved	Gefitinib increases the secretion of DnaJ homolog subfamily B member 1 (DNAJB1).	[22]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Darinaparsin induces a unique cellular response and is active in an arsenic trioxide-resistant myeloma cell line. Mol Cancer Ther. 2009 May;8(5):1197-206.
• [11] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [12] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [13] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [14] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [15] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [16] Proteasome inhibitor PS-341 induces apoptosis through induction of endoplasmic reticulum stress-reactive oxygen species in head and neck squamous cell carcinoma cells. Mol Cell Biol. 2004 Nov;24(22):9695-704. doi: 10.1128/MCB.24.22.9695-9704.2004.
• [17] Survival of retinal pigment epithelium after exposure to prolonged oxidative injury: a detailed gene expression and cellular analysis. Invest Ophthalmol Vis Sci. 2004 Oct;45(10):3767-77.
• [18] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [19] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [20] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [21] Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
• [22] Reactive metabolite of gefitinib activates inflammasomes: implications for gefitinib-induced idiosyncratic reaction. J Toxicol Sci. 2020;45(11):673-680. doi: 10.2131/jts.45.673.
• [23] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [24] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [25] Fluorescent tagging of endogenous Heme oxygenase-1 in human induced pluripotent stem cells for high content imaging of oxidative stress in various differentiated lineages. Arch Toxicol. 2021 Oct;95(10):3285-3302. doi: 10.1007/s00204-021-03127-8. Epub 2021 Sep 4.
• [26] Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
• [27] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [28] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [29] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [30] Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
• [31] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [32] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [33] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [34] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [35] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [36] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [37] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [38] Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.
• [39] Proteasome inhibition in oxidative stress neurotoxicity: implications for heat shock proteins. J Neurochem. 2001 May;77(4):1010-7. doi: 10.1046/j.1471-4159.2001.00302.x.