Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCS9BZY)

• DOT Name: Tetraspanin-13 (TSPAN13)
• Synonyms: Tspan-13; Tetraspan NET-6; Transmembrane 4 superfamily member 13
• Gene Name: TSPAN13
• Related Disease:
  Prostate cancer
  Prostate carcinoma
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Neoplasm
  Prostate neoplasm
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Bone osteosarcoma
  Osteosarcoma
• UniProt ID: TSN13_HUMAN
• Pfam ID: PF00335
• Sequence:
  MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA
  LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARN
  DIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTE
  ILGVWLTYRYRNQKDPRANPSAFL

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Definitive	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[4]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[5]
Thyroid cancer	DIS3VLDH	Strong	Altered Expression	[2]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[2]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Altered Expression	[2]
Thyroid tumor	DISLVKMD	Strong	Altered Expression	[2]
Bone osteosarcoma	DIST1004	Limited	Altered Expression	[6]
Osteosarcoma	DISLQ7E2	Limited	Altered Expression	[6]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Tetraspanin-13 (TSPAN13) affects the response to substance of Topotecan.	[20]
Vinblastine	DM5TVS3	Approved	Tetraspanin-13 (TSPAN13) affects the response to substance of Vinblastine.	[20]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tetraspanin-13 (TSPAN13).	[7]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Tetraspanin-13 (TSPAN13).	[8]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Tetraspanin-13 (TSPAN13).	[9]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Tetraspanin-13 (TSPAN13).	[10]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Tetraspanin-13 (TSPAN13).	[11]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Tetraspanin-13 (TSPAN13).	[13]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Tetraspanin-13 (TSPAN13).	[14]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Tetraspanin-13 (TSPAN13).	[15]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Tetraspanin-13 (TSPAN13).	[16]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Tetraspanin-13 (TSPAN13).	[17]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Tetraspanin-13 (TSPAN13).	[18]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Tetraspanin-13 (TSPAN13).	[19]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Tetraspanin-13 (TSPAN13).	[12]

References

• [1] Urinary Nucleic Acid TSPAN13-to-S100A9 Ratio as a Diagnostic Marker in Prostate Cancer.J Korean Med Sci. 2015 Dec;30(12):1784-92. doi: 10.3346/jkms.2015.30.12.1784. Epub 2015 Nov 30.
• [2] Downregulation of TSPAN13 by miR-369-3p inhibits cell proliferation in papillary thyroid cancer (PTC).Bosn J Basic Med Sci. 2019 May 20;19(2):146-154. doi: 10.17305/bjbms.2018.2865.
• [3] miR-4732-5p promotes breast cancer progression by targeting TSPAN13.J Cell Mol Med. 2019 Apr;23(4):2549-2557. doi: 10.1111/jcmm.14145. Epub 2019 Jan 31.
• [4] Expression of tetraspanins NET-6 and CD151 in breast cancer as a potential tumor biomarker.Clin Exp Med. 2019 Aug;19(3):377-384. doi: 10.1007/s10238-019-00554-x. Epub 2019 Apr 20.
• [5] Gene expression profiling reveals overexpression of TSPAN13 in prostate cancer.Int J Oncol. 2009 Feb;34(2):457-63.
• [6] hTERT promotes tumor progression by enhancing TSPAN13 expression in osteosarcoma cells.Mol Carcinog. 2018 Aug;57(8):1038-1054. doi: 10.1002/mc.22824. Epub 2018 May 18.
• [7] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [8] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [9] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [10] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [11] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [12] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [13] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [14] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [15] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [16] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [17] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [18] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [19] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [20] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.