Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEU05TX)

• DOT Name: Protein phosphatase 1 regulatory subunit 3C (PPP1R3C)
• Synonyms: Protein phosphatase 1 regulatory subunit 5; PP1 subunit R5; Protein targeting to glycogen; PTG
• Gene Name: PPP1R3C
• Related Disease:
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Depression
  Head and neck cancer
  Head and neck carcinoma
  Hepatocellular carcinoma
  Lafora disease
  Non-alcoholic fatty liver disease
  Non-insulin dependent diabetes
  Post-traumatic stress disorder
  Thrombophilia
  Type-1/2 diabetes
• UniProt ID: PPR3C_HUMAN
• PDB ID: 7QF7; 7QFA; 7QFB; 7QM2
• Pfam ID: PF03370
• Sequence:
  MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKS
  CLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLN
  DISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSF
  EKKVQIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPVIPTEQKIEFCISYHA
  NGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQTSPKTELESTIFGSPRLASGL
  FPEWQSWGRMENLASYR
• Function: Acts as a glycogen-targeting subunit for PP1 and regulates its activity. Activates glycogen synthase, reduces glycogen phosphorylase activity and limits glycogen breakdown. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in a variety of cell types.
• KEGG Pathway:
  Insulin sig.ling pathway (hsa04910)
  Insulin resistance (hsa04931)
• Reactome Pathway:
  Myoclonic epilepsy of Lafora (R-HSA-3785653)
  Glycogen synthesis (R-HSA-3322077)

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Colorectal carcinoma	DIS5PYL0	Strong	Posttranslational Modification	[3]
Depression	DIS3XJ69	Strong	Biomarker	[4]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[5]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[6]
Lafora disease	DIS83JHH	Strong	Genetic Variation	[7]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[8]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[9]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[2]
Thrombophilia	DISQR7U7	Strong	Genetic Variation	[10]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[11]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[12]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[13]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[14]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[15]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[16]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[17]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[18]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[19]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[20]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[21]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[22]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[23]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[20]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[24]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[25]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[26]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[27]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[28]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[29]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[30]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[31]
Fenretinide	DMRD5SP	Phase 3	Fenretinide decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[32]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[33]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[35]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[37]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[38]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[39]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[40]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[41]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[42]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[43]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[44]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[19]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein phosphatase 1 regulatory subunit 3C (PPP1R3C).	[34]

References

• [1] The role of rumination in posttraumatic growth in people struggling with cancer.J Psychosoc Oncol. 2019 Sep-Oct;37(5):652-664. doi: 10.1080/07347332.2019.1600628. Epub 2019 May 14.
• [2] The role of posttraumatic stress and posttraumatic growth on online information use in breast cancer survivors.Psychooncology. 2018 Aug;27(8):1971-1978. doi: 10.1002/pon.4753. Epub 2018 May 25.
• [3] Aberrant promoter methylation of PPP1R3C and EFHD1 in plasma of colorectal cancer patients.Cancer Med. 2014 Oct;3(5):1235-45. doi: 10.1002/cam4.273. Epub 2014 May 24.
• [4] Quality of life and posttraumatic growth after adult burn: A prospective, longitudinal study.Burns. 2017 Nov;43(7):1400-1410. doi: 10.1016/j.burns.2017.06.004. Epub 2017 Aug 4.
• [5] Posttraumatic growth in head and neck cancer survivors: Is it possible and what are the correlates?.Psychooncology. 2018 Jun;27(6):1517-1523. doi: 10.1002/pon.4682. Epub 2018 Apr 16.
• [6] Loss of protein targeting to glycogen sensitizes human hepatocellular carcinoma cells towards glucose deprivation mediated oxidative stress and cell death.Biosci Rep. 2015 May 1;35(3):e00207. doi: 10.1042/BSR20150090.
• [7] A PTG variant contributes to a milder phenotype in Lafora disease.PLoS One. 2011;6(6):e21294. doi: 10.1371/journal.pone.0021294. Epub 2011 Jun 30.
• [8] The traditional Chinese formulae Ling-gui-zhu-gan decoction alleviated non-alcoholic fatty liver disease via inhibiting PPP1R3C mediated molecules.BMC Complement Altern Med. 2019 Jan 7;19(1):8. doi: 10.1186/s12906-018-2424-1.
• [9] PPP1R3C mediates metformin-inhibited hepatic gluconeogenesis.Metabolism. 2019 Sep;98:62-75. doi: 10.1016/j.metabol.2019.06.002. Epub 2019 Jun 8.
• [10] Estrogen replacement therapy, thrombophilia, and atherothrombosis.Metabolism. 2002 Jun;51(6):724-32. doi: 10.1053/meta.2002.32729.
• [11] Positive Sides of the Disease: Posttraumatic Growth in Adults with Type 2 Diabetes.Behav Med. 2018 Jan-Mar;44(1):1-10. doi: 10.1080/08964289.2016.1173635. Epub 2016 Jun 23.
• [12] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [13] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [14] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [15] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [16] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [17] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [18] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [19] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [20] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [21] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [22] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [23] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [24] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [25] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [26] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [27] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [28] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [29] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [30] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [31] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [32] The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
• [33] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [34] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [35] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [36] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [37] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [38] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [39] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
• [40] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [41] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [42] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [43] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [44] Effects of nickel treatment on H3K4 trimethylation and gene expression. PLoS One. 2011 Mar 24;6(3):e17728. doi: 10.1371/journal.pone.0017728.