Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEWVFQV)

• DOT Name: Calmegin (CLGN)
• Gene Name: CLGN
• Related Disease:
  Prostate cancer
  Prostate carcinoma
  Seminoma
  Breast cancer
  Breast carcinoma
• UniProt ID: CLGN_HUMAN
• Pfam ID: PF00262
• Sequence:
  MHFQAFWLCLGLLFISINAEFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEV
  YFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH
  AISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMF
  GPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFE
  VLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEP
  AQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKP
  PMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTS
  DIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTA
  GVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEK
  KQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIK
  SVRKRRVRKD
• Function: Functions during spermatogenesis as a chaperone for a range of client proteins that are important for sperm adhesion onto the egg zona pellucida and for subsequent penetration of the zona pellucida. Required for normal sperm migration from the uterus into the oviduct. Required for normal male fertility. Binds calcium ions.
• Tissue Specificity: Detected in testis (at protein level). Detected in testis.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Strong	Genetic Variation	[1]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[1]
Seminoma	DIS3J8LJ	Strong	Altered Expression	[2]
Breast cancer	DIS7DPX1	Limited	Biomarker	[3]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[3]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	Calmegin (CLGN) affects the response to substance of Mitomycin.	[33]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Calmegin (CLGN).	[4]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Calmegin (CLGN).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Calmegin (CLGN).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Calmegin (CLGN).	[7]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Calmegin (CLGN).	[8]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Calmegin (CLGN).	[9]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Calmegin (CLGN).	[10]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Calmegin (CLGN).	[11]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Calmegin (CLGN).	[12]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Calmegin (CLGN).	[13]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Calmegin (CLGN).	[14]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Calmegin (CLGN).	[15]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Calmegin (CLGN).	[16]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Calmegin (CLGN).	[17]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Calmegin (CLGN).	[18]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Calmegin (CLGN).	[16]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Calmegin (CLGN).	[19]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Calmegin (CLGN).	[20]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Calmegin (CLGN).	[17]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Calmegin (CLGN).	[21]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Calmegin (CLGN).	[22]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Calmegin (CLGN).	[17]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Calmegin (CLGN).	[23]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Calmegin (CLGN).	[24]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Calmegin (CLGN).	[25]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of Calmegin (CLGN).	[17]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of Calmegin (CLGN).	[17]
Ampicillin	DMHWE7P	Approved	Ampicillin decreases the expression of Calmegin (CLGN).	[12]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Calmegin (CLGN).	[26]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Calmegin (CLGN).	[27]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Calmegin (CLGN).	[28]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Calmegin (CLGN).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Calmegin (CLGN).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Calmegin (CLGN).	[4]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Calmegin (CLGN).	[31]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Calmegin (CLGN).	[32]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Calmegin (CLGN).	[12]

References

• [1] Heritable methylation marks associated with breast and prostate cancer risk.Prostate. 2018 Sep;78(13):962-969. doi: 10.1002/pros.23654. Epub 2018 May 29.
• [2] Genomic and expression profiling of human spermatocytic seminomas: primary spermatocyte as tumorigenic precursor and DMRT1 as candidate chromosome 9 gene.Cancer Res. 2006 Jan 1;66(1):290-302. doi: 10.1158/0008-5472.CAN-05-2936.
• [3] Soy Foods Might Weaken the Sensitivity of Tamoxifen in Premenopausal Patients With Lumina A Subtype of Breast Cancer.Clin Breast Cancer. 2019 Apr;19(2):e337-e342. doi: 10.1016/j.clbc.2018.12.003. Epub 2018 Dec 12.
• [4] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [5] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [6] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [7] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [8] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [9] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [10] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [11] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [12] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [13] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [14] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [15] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [16] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [17] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [18] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [19] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [20] Impact of extracellular folate levels on global gene expression. Mol Pharmacol. 2001 Dec;60(6):1288-95. doi: 10.1124/mol.60.6.1288.
• [21] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [22] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [23] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [24] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [25] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [26] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [27] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [28] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [29] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [30] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [31] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [32] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [33] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.