Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHZOPSD)

DOT Name Basal cell adhesion molecule (BCAM)
Synonyms Auberger B antigen; B-CAM cell surface glycoprotein; F8/G253 antigen; Lutheran antigen; Lutheran blood group glycoprotein; CD antigen CD239
Gene Name BCAM
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Neoplasm ( )
Advanced cancer ( )
Alzheimer disease ( )
Bladder cancer ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Hepatocellular carcinoma ( )
Hereditary spherocytosis ( )
Sickle-cell anaemia ( )
Skin neoplasm ( )
Squamous cell carcinoma ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Urothelial carcinoma ( )
Carcinoma ( )
Influenza ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid gland follicular carcinoma ( )
Thyroid gland papillary carcinoma ( )
Thyroid tumor ( )
Myeloproliferative neoplasm ( )
UniProt ID
BCAM_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2PET; 2PF6
Pfam ID
PF08205 ; PF13895 ; PF13927 ; PF07686
Sequence
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHD
HYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDE
RDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPA
PKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAH
YSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPE
YTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAY
LDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNG
TYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPD
PKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTV
SPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGS
EQPEQTGLLMGGASGGARGGSGGFGDEC
Function Laminin alpha-5 receptor. May mediate intracellular signaling.
Tissue Specificity Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Definitive Biomarker [1]
Breast carcinoma DIS2UE88 Definitive Biomarker [1]
Neoplasm DISZKGEW Definitive Altered Expression [2]
Advanced cancer DISAT1Z9 Strong Biomarker [3]
Alzheimer disease DISF8S70 Strong Genetic Variation [4]
Bladder cancer DISUHNM0 Strong Biomarker [2]
Colon cancer DISVC52G Strong Biomarker [5]
Colon carcinoma DISJYKUO Strong Biomarker [5]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [6]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [7]
Hereditary spherocytosis DISQYJP5 Strong Biomarker [8]
Sickle-cell anaemia DIS5YNZB Strong Biomarker [9]
Skin neoplasm DIS16DDV Strong Biomarker [10]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [10]
Urinary bladder cancer DISDV4T7 Strong Biomarker [2]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [2]
Urothelial carcinoma DISRTNTN Strong Biomarker [2]
Carcinoma DISH9F1N moderate Altered Expression [11]
Influenza DIS3PNU3 moderate Biomarker [12]
Thyroid cancer DIS3VLDH moderate Biomarker [11]
Thyroid gland carcinoma DISMNGZ0 moderate Biomarker [11]
Thyroid gland follicular carcinoma DISFK2QT moderate Altered Expression [11]
Thyroid gland papillary carcinoma DIS48YMM moderate Altered Expression [11]
Thyroid tumor DISLVKMD moderate Biomarker [11]
Myeloproliferative neoplasm DIS5KAPA Limited Biomarker [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Basal cell adhesion molecule (BCAM) affects the response to substance of Cisplatin. [26]
Mitoxantrone DMM39BF Approved Basal cell adhesion molecule (BCAM) affects the response to substance of Mitoxantrone. [26]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Basal cell adhesion molecule (BCAM). [14]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Basal cell adhesion molecule (BCAM). [15]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Basal cell adhesion molecule (BCAM). [16]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Basal cell adhesion molecule (BCAM). [17]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Basal cell adhesion molecule (BCAM). [18]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Basal cell adhesion molecule (BCAM). [19]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Basal cell adhesion molecule (BCAM). [20]
SB-431542 DM0YOXQ Preclinical SB-431542 increases the expression of Basal cell adhesion molecule (BCAM). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Basal cell adhesion molecule (BCAM). [24]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Basal cell adhesion molecule (BCAM). [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Basal cell adhesion molecule (BCAM). [21]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Basal cell adhesion molecule (BCAM). [22]
------------------------------------------------------------------------------------

References

1 Internalization of CD239 highly expressed in breast cancer cells: a potential antigen for antibody-drug conjugates.Sci Rep. 2018 Apr 26;8(1):6612. doi: 10.1038/s41598-018-24961-4.
2 The role of Lutheran/basal cell adhesion molecule in human bladder carcinogenesis.J Biomed Sci. 2017 Aug 26;24(1):61. doi: 10.1186/s12929-017-0360-x.
3 Tools for the assessment of breast cancer screening beliefs in women: a literature review.J Comp Eff Res. 2019 Jul;8(9):645-655. doi: 10.2217/cer-2018-0142. Epub 2019 Jul 12.
4 Genome-wide meta-analysis identifies new loci and functional pathways influencing Alzheimer's disease risk.Nat Genet. 2019 Mar;51(3):404-413. doi: 10.1038/s41588-018-0311-9. Epub 2019 Jan 7.
5 A unique gene encodes spliceoforms of the B-cell adhesion molecule cell surface glycoprotein of epithelial cancer and of the Lutheran blood group glycoprotein.Blood. 1996 Sep 1;88(5):1865-72.
6 BCAM and LAMA5 Mediate the Recognition between Tumor Cells and the Endothelium in the Metastatic Spreading of KRAS-Mutant Colorectal Cancer.Clin Cancer Res. 2016 Oct 1;22(19):4923-4933. doi: 10.1158/1078-0432.CCR-15-2664. Epub 2016 May 3.
7 Soluble Lutheran/basal cell adhesion molecule is detectable in plasma of hepatocellular carcinoma patients and modulates cellular interaction with laminin-511 in vitro.Exp Cell Res. 2014 Oct 15;328(1):197-206. doi: 10.1016/j.yexcr.2014.07.012. Epub 2014 Jul 19.
8 Role of Lu/BCAM glycoproteins in red cell diseases.Transfus Clin Biol. 2010 Sep;17(3):143-7. doi: 10.1016/j.tracli.2010.06.002. Epub 2010 Jul 23.
9 Aggregation of mononuclear and red blood cells through an {alpha}4{beta}1-Lu/basal cell adhesion molecule interaction in sickle cell disease.Haematologica. 2010 Nov;95(11):1841-8. doi: 10.3324/haematol.2010.026294. Epub 2010 Jun 18.
10 Molecular interactions of B-CAM (basal-cell adhesion molecule) and laminin in epithelial skin cancer.Arch Dermatol Res. 2004 Jul;296(2):59-66. doi: 10.1007/s00403-004-0481-4. Epub 2004 Jun 15.
11 DARC (Duffy) and BCAM (Lutheran) reduced expression in thyroid cancer.Blood Cells Mol Dis. 2013 Mar;50(3):161-5. doi: 10.1016/j.bcmd.2012.10.009. Epub 2012 Nov 17.
12 Benign Acute Childhood Myositis During Influenza B Outbreak.Adv Exp Med Biol. 2018;1039:29-34. doi: 10.1007/5584_2017_79.
13 Erythrocytes from patients with myeloproliferative neoplasms and splanchnic venous thrombosis show greater expression of Lu/BCAM.Int J Lab Hematol. 2018 Aug;40(4):473-477. doi: 10.1111/ijlh.12838. Epub 2018 May 13.
14 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
15 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
16 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
17 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
18 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
19 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
20 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
21 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
22 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
23 Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
24 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
25 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
26 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.