Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI1XQTO)

• DOT Name: Kinesin-like protein KIF1B (KIF1B)
• Synonyms: Klp
• Gene Name: KIF1B
• Related Disease:
  Polyneuropathy
  Advanced cancer
  Alzheimer disease
  Amyloidosis
  Amyotrophic lateral sclerosis
  Autosomal dominant optic atrophy, classic form
  Cataract
  Charcot marie tooth disease
  Charcot-Marie-Tooth disease type 1
  Charcot-Marie-Tooth disease type 1A
  Charcot-Marie-Tooth disease type 2
  Charcot-Marie-Tooth disease type 3
  Clear cell renal carcinoma
  Epithelial ovarian cancer
  Gastric cancer
  Glioma
  Hepatitis
  Hepatitis A virus infection
  Hepatitis C virus infection
  Hereditary motor and sensory neuropathy
  Hereditary motor and sensory neuropathy type 6
  Hereditary spastic paraplegia
  Isolated congenital microcephaly
  Medulloblastoma
  Neuromuscular disease
  Peripheral neuropathy
  Peripheral sensory neuropathies
  Renal cell carcinoma
  Spinal muscular atrophy
  Stomach cancer
  Vascular purpura
  Breast cancer
  Breast carcinoma
  Her2-receptor negative breast cancer
  Hereditary neuropathy with liability to pressure palsies
  Pheochromocytoma
  Stroke
  Charcot-Marie-Tooth disease type 2A1
  Hereditary pheochromocytoma-paraganglioma
  Corpus callosum, agenesis of
  Hereditary spastic paraplegia 10
  Intellectual disability
  Motor neurone disease
  Multiple sclerosis
  Nervous system disease
  Neuroblastoma, susceptibility to, 1
• UniProt ID: KIF1B_HUMAN
• PDB ID: 2EH0
• Pfam ID: PF12473 ; PF00498 ; PF12423 ; PF00225 ; PF16183 ; PF00169
• Sequence:
  MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
  SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
  QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
  LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEK
  VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
  TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVI
  NEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGSKYLKDFQNNKHRYL
  LASENQRPGHFSTASMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLKES
  EKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNED
  PLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPC
  ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWT
  FAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQKQVET
  RSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAIS
  VELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYW
  SLEKLKQRLDLMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHWFKLVGSSPIFHGCV
  NERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSDAGTEEGSDLFSDGH
  DPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAP
  DYGSGIRQSGTAKISFDNEYFNQSDFSSVAMTRSGLSLEELRIVEGQGQSSEVITPPEEI
  SRINDLDLKSSTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQF
  NFLHRHDEAFSTEPLKNNGRGSPLAFYHVQNIAVEITESFVDYIKTKPIVFEVFGHYQQH
  PLHLQGQELNSPPQPCRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISE
  LEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIR
  NKPEVDEAAVDAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEK
  IYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTG
  IYELSLCKMSDTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLE
  LLHEVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITP
  SESSGYDSGDIESLVDREKELATKCLQLLTHTFNREFSQVHGSVSDCKLSDISPIGRDPS
  ESSFSSATLTPSSTCPSLVDSRSNSLDQKTPEANSRASSPCPEFEQFQIVPAVETPYLAR
  AGKNEFLNLVPDIEEIRPSSVVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPV
  ERGIINLSTAQVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAG
  TIRSKLSRRCPSQSKY
• Function: Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility. Isoform 2 is required for induction of neuronal apoptosis; Isoform 1 mediates the transport of synaptic vesicles in neuronal cells.
• Tissue Specificity: Isoform 3 is abundant in the skeletal muscle. It is also expressed in fetal brain, lung and kidney, and adult heart, placenta, testis, ovary and small intestine. Isoform 2 is abundant in the brain and also expressed in fetal heart, lung, liver and kidney, and adult skeletal muscle, placenta, liver, kidney, heart, spleen, thymus, prostate, testis, ovary, small intestine, colon and pancreas.
• KEGG Pathway: Motor proteins (hsa04814)
• Reactome Pathway:
  Kinesins (R-HSA-983189)
  COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Polyneuropathy	DISB9G3W	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[3]
Amyloidosis	DISHTAI2	Strong	Genetic Variation	[4]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[5]
Autosomal dominant optic atrophy, classic form	DISXUAV9	Strong	Biomarker	[6]
Cataract	DISUD7SL	Strong	Genetic Variation	[7]
Charcot marie tooth disease	DIS3BT2L	Strong	Biomarker	[8]
Charcot-Marie-Tooth disease type 1	DIS56F9A	Strong	Biomarker	[9]
Charcot-Marie-Tooth disease type 1A	DISSRZG7	Strong	Biomarker	[10]
Charcot-Marie-Tooth disease type 2	DISR30O9	Strong	Biomarker	[11]
Charcot-Marie-Tooth disease type 3	DIS6DQK1	Strong	Biomarker	[12]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[14]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[15]
Glioma	DIS5RPEH	Strong	Biomarker	[16]
Hepatitis	DISXXX35	Strong	Genetic Variation	[17]
Hepatitis A virus infection	DISUMFQV	Strong	Genetic Variation	[17]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[18]
Hereditary motor and sensory neuropathy	DISR0X2K	Strong	Genetic Variation	[19]
Hereditary motor and sensory neuropathy type 6	DIS27OAR	Strong	Genetic Variation	[7]
Hereditary spastic paraplegia	DISGZQV1	Strong	Biomarker	[20]
Isolated congenital microcephaly	DISUXHZ6	Strong	Biomarker	[21]
Medulloblastoma	DISZD2ZL	Strong	Genetic Variation	[22]
Neuromuscular disease	DISQTIJZ	Strong	Genetic Variation	[23]
Peripheral neuropathy	DIS7KN5G	Strong	Genetic Variation	[24]
Peripheral sensory neuropathies	DISYWI6M	Strong	Genetic Variation	[25]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[13]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[26]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[15]
Vascular purpura	DIS6ZZMF	Strong	Biomarker	[20]
Breast cancer	DIS7DPX1	moderate	Biomarker	[27]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[27]
Her2-receptor negative breast cancer	DISS605N	moderate	Biomarker	[27]
Hereditary neuropathy with liability to pressure palsies	DISY0X1V	moderate	Biomarker	[28]
Pheochromocytoma	DIS56IFV	Moderate	Autosomal dominant	[29]
Stroke	DISX6UHX	moderate	Genetic Variation	[30]
Charcot-Marie-Tooth disease type 2A1	DISCM811	Supportive	Autosomal dominant	[31]
Hereditary pheochromocytoma-paraganglioma	DISP9K7L	Supportive	Autosomal dominant	[22]
Corpus callosum, agenesis of	DISO9P40	Limited	Genetic Variation	[32]
Hereditary spastic paraplegia 10	DISYFO3L	Limited	Biomarker	[33]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[32]
Motor neurone disease	DISUHWUI	Limited	Genetic Variation	[5]
Multiple sclerosis	DISB2WZI	Limited	Altered Expression	[34]
Nervous system disease	DISJ7GGT	Limited	Genetic Variation	[35]
Neuroblastoma, susceptibility to, 1	DIS2XL1O	Limited	Autosomal dominant	[29]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Kinesin-like protein KIF1B (KIF1B) affects the response to substance of Doxorubicin.	[51]
Vinblastine	DM5TVS3	Approved	Kinesin-like protein KIF1B (KIF1B) affects the response to substance of Vinblastine.	[51]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Kinesin-like protein KIF1B (KIF1B).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Kinesin-like protein KIF1B (KIF1B).	[37]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Kinesin-like protein KIF1B (KIF1B).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Kinesin-like protein KIF1B (KIF1B).	[39]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Kinesin-like protein KIF1B (KIF1B).	[39]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Kinesin-like protein KIF1B (KIF1B).	[40]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Kinesin-like protein KIF1B (KIF1B).	[41]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Kinesin-like protein KIF1B (KIF1B).	[42]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Kinesin-like protein KIF1B (KIF1B).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Kinesin-like protein KIF1B (KIF1B).	[45]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Kinesin-like protein KIF1B (KIF1B).	[48]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Kinesin-like protein KIF1B (KIF1B).	[49]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Kinesin-like protein KIF1B (KIF1B).	[50]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Kinesin-like protein KIF1B (KIF1B).	[43]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Kinesin-like protein KIF1B (KIF1B).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Kinesin-like protein KIF1B (KIF1B).	[47]

References

• [1] Clinical and allelic heterogeneity in a pediatric cohort of 11 patients carrying MFN2 mutation.Brain Dev. 2016 May;38(5):498-506. doi: 10.1016/j.braindev.2015.11.006. Epub 2015 Dec 10.
• [2] Genome-wide association study identifies 1p36.22 as a new susceptibility locus for hepatocellular carcinoma in chronic hepatitis B virus carriers.Nat Genet. 2010 Sep;42(9):755-8. doi: 10.1038/ng.638. Epub 2010 Aug 1.
• [3] Overexpression of Kinesin Superfamily Motor Proteins in Alzheimer's Disease.J Alzheimers Dis. 2017;60(4):1511-1524. doi: 10.3233/JAD-170094.
• [4] Autosomal-dominant transthyretin (TTR)-related amyloidosis is not a frequent CMT2 neuropathy "in disguise".Orphanet J Rare Dis. 2018 Oct 4;13(1):177. doi: 10.1186/s13023-018-0917-0.
• [5] Co-occurrence of amyotrophic lateral sclerosis and Charcot-Marie-Tooth disease type 2A in a patient with a novel mutation in the mitofusin-2 gene.Neuromuscul Disord. 2011 Feb;21(2):129-31. doi: 10.1016/j.nmd.2010.09.009. Epub 2010 Oct 14.
• [6] Mutations in SLC25A46, encoding a UGO1-like protein, cause an optic atrophy spectrum disorder. Nat Genet. 2015 Aug;47(8):926-32. doi: 10.1038/ng.3354. Epub 2015 Jul 13.
• [7] Retinal ganglion cell neurodegeneration in mitochondrial inherited disorders.Biochim Biophys Acta. 2009 May;1787(5):518-28. doi: 10.1016/j.bbabio.2009.02.024. Epub 2009 Mar 5.
• [8] PFN2 and GAMT as common molecular determinants of axonal Charcot-Marie-Tooth disease.J Neurol Neurosurg Psychiatry. 2018 Aug;89(8):870-878. doi: 10.1136/jnnp-2017-317562. Epub 2018 Feb 15.
• [9] Mutations in the peripheral myelin genes and associated genes in inherited peripheral neuropathies.Hum Mutat. 1999;13(1):11-28. doi: 10.1002/(SICI)1098-1004(1999)13:1<11::AID-HUMU2>3.0.CO;2-A.
• [10] Characterization of Charcot-Marie-Tooth optic neuropathy.J Neurol. 2017 Dec;264(12):2431-2435. doi: 10.1007/s00415-017-8645-2. Epub 2017 Oct 23.
• [11] A novel type of hereditary motor and sensory neuropathy characterized by a mild phenotype.Arch Neurol. 1999 Oct;56(10):1283-8. doi: 10.1001/archneur.56.10.1283.
• [12] Cellular characterization of MPZ mutations presenting with diverse clinical phenotypes.J Neurol. 2010 Oct;257(10):1661-8. doi: 10.1007/s00415-010-5590-8. Epub 2010 May 12.
• [13] Expression and functional role of miR-29b in renal cell carcinoma.Int J Clin Exp Pathol. 2015 Nov 1;8(11):14161-70. eCollection 2015.
• [14] Polymorphisms in the kinesin-like factor 1 B gene and risk of epithelial ovarian cancer in Eastern Chinese women.Tumour Biol. 2015 Sep;36(9):6919-27. doi: 10.1007/s13277-015-3394-2. Epub 2015 Apr 9.
• [15] Leptin-mediated regulation of MT1-MMP localization is KIF1B dependent and enhances gastric cancer cell invasion.Carcinogenesis. 2013 May;34(5):974-83. doi: 10.1093/carcin/bgt028. Epub 2013 Jan 25.
• [16] KIF1B promotes glioma migration and invasion via cell surface localization of MT1-MMP.Oncol Rep. 2016 Feb;35(2):971-7. doi: 10.3892/or.2015.4426. Epub 2015 Nov 16.
• [17] Role of single nucleotide polymorphisms of KIF1B gene in HBV-associated viral hepatitis.PLoS One. 2012;7(9):e45128. doi: 10.1371/journal.pone.0045128. Epub 2012 Sep 18.
• [18] Replication of genome wide association studies on hepatocellular carcinoma susceptibility loci in a Chinese population.PLoS One. 2013 Oct 28;8(10):e77315. doi: 10.1371/journal.pone.0077315. eCollection 2013.
• [19] Severe demyelinating hypertrophic polyneuropathy caused by a de novo frameshift mutation within the intracellular domain of myelin protein zero (MPZ/P0).J Neurol Sci. 2009 Jun 15;281(1-2):113-5. doi: 10.1016/j.jns.2009.03.008. Epub 2009 Apr 3.
• [20] A network biology approach to unraveling inherited axonopathies.Sci Rep. 2019 Feb 8;9(1):1692. doi: 10.1038/s41598-018-37119-z.
• [21] The polynucleotide kinase 3'-phosphatase gene (PNKP) is involved in Charcot-Marie-Tooth disease (CMT2B2) previously related to MED25. Neurogenetics. 2018 Dec;19(4):215-225. doi: 10.1007/s10048-018-0555-7. Epub 2018 Jul 24.
• [22] The kinesin KIF1Bbeta acts downstream from EglN3 to induce apoptosis and is a potential 1p36 tumor suppressor. Genes Dev. 2008 Apr 1;22(7):884-93. doi: 10.1101/gad.1648608. Epub 2008 Mar 11.
• [23] Expanding the spectrum of genes responsible for hereditary motor neuropathies.J Neurol Neurosurg Psychiatry. 2019 Oct;90(10):1171-1179. doi: 10.1136/jnnp-2019-320717. Epub 2019 Jun 5.
• [24] Altered interplay between endoplasmic reticulum and mitochondria in Charcot-Marie-Tooth type 2A neuropathy.Proc Natl Acad Sci U S A. 2019 Feb 5;116(6):2328-2337. doi: 10.1073/pnas.1810932116. Epub 2019 Jan 18.
• [25] Late-onset hereditary sensory and autonomic neuropathy expands the phenotypic spectrum of MFN2-related diseases.Neuropathology. 2018 Oct;38(5):463-467. doi: 10.1111/neup.12487. Epub 2018 Jul 16.
• [26] Molecular genetics and mechanisms of disease in distal hereditary motor neuropathies: insights directing future genetic studies.Curr Mol Med. 2011 Nov;11(8):650-65. doi: 10.2174/156652411797536714.
• [27] KLP-PI: a new prognostic index for luminal B HER-2-negative breast cancer.Hum Cell. 2019 Apr;32(2):172-184. doi: 10.1007/s13577-018-00229-x. Epub 2018 Dec 17.
• [28] Clinical and genetic spectra in a series of Chinese patients with Charcot-Marie-Tooth disease.Clin Chim Acta. 2015 Dec 7;451(Pt B):263-70. doi: 10.1016/j.cca.2015.10.007. Epub 2015 Oct 8.
• [29] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [30] Mutation screening of mitofusin 2 in Charcot-Marie-Tooth disease type 2.J Neurol. 2011 Jul;258(7):1234-9. doi: 10.1007/s00415-011-5910-7. Epub 2011 Jan 22.
• [31] Charcot-Marie-Tooth disease type 2A caused by mutation in a microtubule motor KIF1Bbeta. Cell. 2001 Jun 1;105(5):587-97. doi: 10.1016/s0092-8674(01)00363-4.
• [32] Charcot-Marie-Tooth disease (CMT): distinctive phenotypic and genotypic features in CMT type 2.J Neurol Sci. 2001 Feb 15;184(1):1-9. doi: 10.1016/s0022-510x(00)00497-4.
• [33] Genome-wide Analyses Identify KIF5A as a Novel ALS Gene.Neuron. 2018 Mar 21;97(6):1267-1288. doi: 10.1016/j.neuron.2018.02.027.
• [34] Reduced axonal motor protein expression in non-lesional grey matter in multiple sclerosis.Mult Scler. 2014 Jun;20(7):812-21. doi: 10.1177/1352458513508836. Epub 2013 Oct 21.
• [35] A novel p.Val244Leu mutation in MFN2 leads to Charcot-Marie-Tooth disease type 2.Ital J Pediatr. 2016 Mar 8;42:28. doi: 10.1186/s13052-016-0237-8.
• [36] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Identification of biomarkers for the initiation of apoptosis in human preneoplastic colonocytes by proteome analysis. Int J Cancer. 2004 Mar 20;109(2):220-9. doi: 10.1002/ijc.11692.
• [39] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [40] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [41] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [42] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [47] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [48] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [49] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [50] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [51] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.