Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIIXE4M)

• DOT Name: Laminin subunit alpha-5 (LAMA5)
• Synonyms: Laminin-10 subunit alpha; Laminin-11 subunit alpha; Laminin-15 subunit alpha
• Gene Name: LAMA5
• Related Disease:
  Advanced cancer
  Alport syndrome
  Autosomal dominant polycystic kidney disease
  Breast neoplasm
  Colon cancer
  Colorectal adenocarcinoma
  Colorectal adenoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal neoplasm
  Congenital myasthenic syndrome
  Cystic kidney disease
  Focal segmental glomerulosclerosis
  Hepatocellular carcinoma
  Hypospadias
  Kidney failure
  Mucopolysaccharidosis
  Myopia
  Neoplasm
  Nephropathy
  Nephrotic syndrome, IIa 26
  Polycythemia vera
  Prostate neoplasm
  Nephrotic syndrome
  Plasma cell myeloma
  LAMA5-related multisystemic syndrome
  Glioma
  Junctional epidermolysis bullosa
  Adult glioblastoma
  Asthma
  Breast cancer
  Breast carcinoma
• UniProt ID: LAMA5_HUMAN
• PDB ID: 5XAU; 7CEC
• Pfam ID: PF00052 ; PF00053 ; PF00054 ; PF02210 ; PF06008 ; PF06009 ; PF00055
• Sequence:
  MAKRLCAGSALCVRGPRGPAPLLLVGLALLGAARAREEAGGGFSLHPPYFNLAEGARIAA
  SATCGEEAPARGSPRPTEDLYCKLVGGPVAGGDPNQTIRGQYCDICTAANSNKAHPASNA
  IDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGR
  TYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPG
  AMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
  VCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCN
  CYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPL
  DSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSND
  TREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCELCAPGFYGPGCQP
  CQCSSPGVADDRCDPDTGQCRCRVGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCD
  EAGRCLCQPEFAGPHCDRCRPGYHGFPNCQACTCDPRGALDQLCGAGGLCRCRPGYTGTA
  CQECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRPRVTGLRCDTCVPGAYNFPYC
  EAGSCHPAGLAPVDPALPEAQVPCMCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDL
  RGTLGGVAECQPGTGQCFCKPHVCGQACASCKDGFFGLDQADYFGCRSCRCDIGGALGQS
  CEPRTGVCRCRPNTQGPTCSEPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
  FSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSATCANC
  TAQSQPVAFPPSTEPAFITVPQRGFGEPFVLNPGTWALRVEAEGVLLDYVVLLPSAYYEA
  ALLQLRVTEACTYRPSAQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQL
  SPSHPPLITCTGSDVDVQLQVAVPQPGRYALVVEYANEDARQEVGVAVHTPQRAPQQGLL
  SLHPCLYSTLCRGTARDTQDHLAVFHLDSEASVRLTAEQARFFLHGVTLVPIEEFSPEFV
  EPRVSCISSHGAFGPNSAACLPSRFPKPPQPIILRDCQVIPLPPGLPLTHAQDLTPAMSP
  AGPRPRPPTAVDPDAEPTLLREPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLIN
  AGRVWQGHANASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPKGRWLWLDYVLVVP
  ENVYSFGYLREEPLDKSYDFISHCAAQGYHISPSSSSLFCRNAAASLSLFYNNGARPCGC
  HEVGATGPTCEPFGGQCPCHAHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCIC
  PPRTIPPDCLLCQPQTFGCHPLVGCEECNCSGPGIQELTDPTCDTDSGQCKCRPNVTGRR
  CDTCSPGFHGYPRCRPCDCHEAGTAPGVCDPLTGQCYCKENVQGPKCDQCSLGTFSLDAA
  NPKGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSTDRQVVPHERQPGTEMLRADLRH
  VPEAVPEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFVPMESRPDVVLQGN
  QMSITFLEPAYPTPGHVHRGQLQLVEGNFRHTETRNTVSREELMMVLASLEQLQIRALFS
  QISSAVFLRRVALEVASPAGQGALASNVELCLCPASYRGDSCQECAPGFYRDVKGLFLGR
  CVPCQCHGHSDRCLPGSGVCVDCQHNTEGAHCERCQAGFVSSRDDPSAPCVSCPCPLSVP
  SNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLL
  FSDCDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCDCTPCGTEACDPHSGHC
  LCKAGVTGRRCDRCQEGHFGFDGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCR
  ECAPGYWGLPEQGCRRCQCPGGRCDPHTGRCNCPPGLSGERCDTCSQQHQVPVPGGPVGH
  SIHCEVCDHCVVLLLDDLERAGALLPAIHEQLRGINASSMAWARLHRLNASIADLQSQLR
  SPLGPRHETAQQLEVLEQQSTSLGQDARRLGGQAVGTRDQASQLLAGTEATLGHAKTLLA
  AIRAVDRTLSELMSQTGHLGLANASAPSGEQLLRTLAEVERLLWEMRARDLGAPQAAAEA
  ELAAAQRLLARVQEQLSSLWEENQALATQTRDRLAQHEAGLMDLREALNRAVDATREAQE
  LNSRNQERLEEALQRKQELSRDNATLQATLHAARDTLASVFRLLHSLDQAKEELERLAAS
  LDGARTPLLQRMQTFSPAGSKLRLVEAAEAHAQQLGQLALNLSSIILDVNQDRLTQRAIE
  ASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQ
  QRLGLVWAALQGARTQLRDVRAKKDQLEAHIQAAQAMLAMDTDETSKKIAHAKAVAAEAQ
  DTATRVQSQLQAMQENVERWQGQYEGLRGQDLGQAVLDAGHSVSTLEKTLPQLLAKLSIL
  ENRGVHNASLALSASIGRVRELIAQARGAASKVKVPMKFNGRSGVQLRTPRDLADLAAYT
  ALKFYLQGPEPEPGQGTEDRFVMYMGSRQATGDYMGVSLRDKKVHWVYQLGEAGPAVLSI
  DEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGG
  YPSTFTPPPLLRFPGYRGCIEMDTLNEEVVSLYNFERTFQLDTAVDRPCARSKSTGDPWL
  TDGSYLDGTGFARISFDSQISTTKRFEQELRLVSYSGVLFFLKQQSQFLCLAVQEGSLVL
  LYDFGAGLKKAVPLQPPPPLTSASKAIQVFLLGGSRKRVLVRVERATVYSVEQDNDLELA
  DAYYLGGVPPDQLPPSLRRLFPTGGSVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLL
  VGRAMTFHGHGFLRLALSNVAPLTGNVYSGFGFHSAQDSALLYYRASPDGLCQVSLQQGR
  VSLQLLRTEVKTQAGFADGAPHYVAFYSNATGVWLYVDDQLQQMKPHRGPPPELQPQPEG
  PPRLLLGGLPESGTIYNFSGCISNVFVQRLLGPQRVFDLQQNLGSVNVSTGCAPALQAQT
  PGLGPRGLQATARKASRRSRQPARHPACMLPPHLRTTRDSYQFGGSLSSHLEFVGILARH
  RNWPSLSMHVLPRSSRGLLLFTARLRPGSPSLALFLSNGHFVAQMEGLGTRLRAQSRQRS
  RPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSK
  LPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATL
  PDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVL
  CDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPA
  YCGCMRRLAVNRSPVAMTRSVEVHGAVGASGCPAA
• Function: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Plays a role in the regulation of skeletogenesis, through a mechanism that involves integrin-mediated signaling and PTK2B/PYK2.
• Tissue Specificity: Expressed in heart, lung, kidney, skeletal muscle, pancreas, retina and placenta. Little or no expression in brain and liver. Expressed in muscle, ligaments, periosteum, trabecular bone and throughout the cartilage, particularly in the growth plate and in articular chondrocytes .
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Human papillomavirus infection (hsa05165)
  Pathways in cancer (hsa05200)
  Small cell lung cancer (hsa05222)
• Reactome Pathway:
  Laminin interactions (R-HSA-3000157)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  MET activates PTK2 signaling (R-HSA-8874081)
  Degradation of the extracellular matrix (R-HSA-1474228)

Molecular Interaction Atlas (MIA) of This DOT

34 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Alport syndrome	DIS25AB4	Strong	Biomarker	[2]
Autosomal dominant polycystic kidney disease	DISBHWUI	Strong	Biomarker	[3]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[4]
Colon cancer	DISVC52G	Strong	Genetic Variation	[5]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[5]
Colorectal adenoma	DISTSVHM	Strong	Genetic Variation	[5]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[5]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[5]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[5]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[5]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[5]
Congenital myasthenic syndrome	DISJLG2T	Strong	Genetic Variation	[6]
Cystic kidney disease	DISRT1LM	Strong	Altered Expression	[2]
Focal segmental glomerulosclerosis	DISJNHH0	Strong	Genetic Variation	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[7]
Hypospadias	DIS48CCP	Strong	Biomarker	[8]
Kidney failure	DISOVQ9P	Strong	Genetic Variation	[9]
Mucopolysaccharidosis	DISB083T	Strong	Biomarker	[10]
Myopia	DISK5S60	Strong	Genetic Variation	[11]
Neoplasm	DISZKGEW	Strong	Biomarker	[12]
Nephropathy	DISXWP4P	Strong	Genetic Variation	[2]
Nephrotic syndrome, IIa 26	DISJ1V40	Strong	Autosomal recessive	[13]
Polycythemia vera	DISB5FPO	Strong	Biomarker	[14]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[15]
Nephrotic syndrome	DISSPSC2	moderate	Genetic Variation	[16]
Plasma cell myeloma	DIS0DFZ0	moderate	Genetic Variation	[17]
LAMA5-related multisystemic syndrome	DISN9TY8	Supportive	Autosomal dominant	[1]
Glioma	DIS5RPEH	Disputed	Biomarker	[18]
Junctional epidermolysis bullosa	DISJRXWU	Disputed	Biomarker	[19]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[20]
Asthma	DISW9QNS	Limited	Biomarker	[21]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[22]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[22]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Laminin subunit alpha-5 (LAMA5).	[23]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Laminin subunit alpha-5 (LAMA5).	[24]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Laminin subunit alpha-5 (LAMA5).	[25]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Laminin subunit alpha-5 (LAMA5).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Laminin subunit alpha-5 (LAMA5).	[27]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Laminin subunit alpha-5 (LAMA5).	[29]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Laminin subunit alpha-5 (LAMA5).	[30]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Laminin subunit alpha-5 (LAMA5).	[31]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Laminin subunit alpha-5 (LAMA5).	[32]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Laminin subunit alpha-5 (LAMA5).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Laminin subunit alpha-5 (LAMA5).	[35]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Laminin subunit alpha-5 (LAMA5).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Laminin subunit alpha-5 (LAMA5).	[37]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Laminin subunit alpha-5 (LAMA5).	[38]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Laminin subunit alpha-5 (LAMA5).	[28]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Laminin subunit alpha-5 (LAMA5).	[34]

References

• [1] Identification of the first dominant mutation of LAMA5 gene causing a complex multisystem syndrome due to dysfunction of the extracellular matrix. J Med Genet. 2017 Oct;54(10):710-720. doi: 10.1136/jmedgenet-2017-104555. Epub 2017 Jul 22.
• [2] COL4A5 and LAMA5 variants co-inherited in familial hematuria: digenic inheritance or genetic modifier effect?.BMC Nephrol. 2018 May 16;19(1):114. doi: 10.1186/s12882-018-0906-5.
• [3] Laminin 5 regulates polycystic kidney cell proliferation and cyst formation.J Biol Chem. 2006 Sep 29;281(39):29181-9. doi: 10.1074/jbc.M606151200. Epub 2006 Jul 26.
• [4] Autocrine laminin-5 ligates alpha6beta4 integrin and activates RAC and NFkappaB to mediate anchorage-independent survival of mammary tumors.J Cell Biol. 2003 Dec 22;163(6):1397-407. doi: 10.1083/jcb.200302023.
• [5] Discovery of common and rare genetic risk variants for colorectal cancer.Nat Genet. 2019 Jan;51(1):76-87. doi: 10.1038/s41588-018-0286-6. Epub 2018 Dec 3.
• [6] A presynaptic congenital myasthenic syndrome attributed to a homozygous sequence variant in LAMA5.Ann N Y Acad Sci. 2018 Feb;1413(1):119-125. doi: 10.1111/nyas.13585. Epub 2018 Jan 28.
• [7] Laminin alpha 5 mediates ectopic adhesion of hepatocellular carcinoma through integrins and/or Lutheran/basal cell adhesion molecule.Exp Cell Res. 2008 Aug 15;314(14):2579-90. doi: 10.1016/j.yexcr.2008.05.021. Epub 2008 Jun 7.
• [8] Requirement for basement membrane laminin 5 during urethral and external genital development.Mech Dev. 2016 Aug;141:62-69. doi: 10.1016/j.mod.2016.05.004. Epub 2016 May 18.
• [9] Glomerular basement membrane and related glomerular disease.Transl Res. 2012 Oct;160(4):291-7. doi: 10.1016/j.trsl.2012.03.004. Epub 2012 Apr 10.
• [10] Substrate accumulation and extracellular matrix remodelling promote persistent upper airway disease in mucopolysaccharidosis patients on enzyme replacement therapy.PLoS One. 2018 Sep 18;13(9):e0203216. doi: 10.1371/journal.pone.0203216. eCollection 2018.
• [11] Presynaptic congenital myasthenic syndrome with a homozygous sequence variant in LAMA5 combines myopia, facial tics, and failure of neuromuscular transmission.Am J Med Genet A. 2017 Aug;173(8):2240-2245. doi: 10.1002/ajmg.a.38291. Epub 2017 May 25.
• [12] BCAM and LAMA5 Mediate the Recognition between Tumor Cells and the Endothelium in the Metastatic Spreading of KRAS-Mutant Colorectal Cancer.Clin Cancer Res. 2016 Oct 1;22(19):4923-4933. doi: 10.1158/1078-0432.CCR-15-2664. Epub 2016 May 3.
• [13] [Anthroposophic medicine]. Tidsskr Nor Laegeforen. 1986 Feb 20;106(5):426-31.
• [14] Increased adhesion to endothelial cells of erythrocytes from patients with polycythemia vera is mediated by laminin alpha5 chain and Lu/BCAM.Blood. 2007 Aug 1;110(3):894-901. doi: 10.1182/blood-2006-10-048298. Epub 2007 Apr 5.
• [15] Membrane type 1 matrix metalloprotease cleaves laminin-10 and promotes prostate cancer cell migration.Neoplasia. 2005 Apr;7(4):380-9. doi: 10.1593/neo.04619.
• [16] Genetic variants in the LAMA5 gene in pediatric nephrotic syndrome.Nephrol Dial Transplant. 2019 Mar 1;34(3):485-493. doi: 10.1093/ndt/gfy028.
• [17] Focusing on long non-coding RNA dysregulation in newly diagnosed multiple myeloma.Life Sci. 2018 Mar 1;196:133-142. doi: 10.1016/j.lfs.2018.01.025. Epub 2018 Feb 3.
• [18] Laminin isoforms and their integrin receptors in glioma cell migration and invasiveness: Evidence for a role of alpha5-laminin(s) and alpha3beta1 integrin.Exp Cell Res. 2007 Nov 1;313(18):3819-31. doi: 10.1016/j.yexcr.2007.07.038. Epub 2007 Aug 16.
• [19] Biological function of laminin-5 and pathogenic impact of its deficiency.Eur J Cell Biol. 2007 Dec;86(11-12):701-17. doi: 10.1016/j.ejcb.2006.07.004. Epub 2006 Sep 26.
• [20] Quantification of glioblastoma progression in zebrafish xenografts: Adhesion to laminin alpha 5 promotes glioblastoma microtumor formation and inhibits cell invasion.Biochem Biophys Res Commun. 2018 Dec 2;506(4):833-839. doi: 10.1016/j.bbrc.2018.10.076. Epub 2018 Oct 30.
• [21] Laminin 4 contributes to airway remodeling and inflammation in asthma.Am J Physiol Lung Cell Mol Physiol. 2019 Dec 1;317(6):L768-L777. doi: 10.1152/ajplung.00222.2019. Epub 2019 Sep 25.
• [22] Integrin 31 can function to promote spontaneous metastasis and lung colonization of invasive breast carcinoma.Mol Cancer Res. 2014 Jan;12(1):143-154. doi: 10.1158/1541-7786.MCR-13-0184. Epub 2013 Sep 3.
• [23] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [24] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [25] Constitutive gene expression predisposes morphogen-mediated cell fate responses of NT2/D1 and 27X-1 human embryonal carcinoma cells. Stem Cells. 2007 Mar;25(3):771-8. doi: 10.1634/stemcells.2006-0271. Epub 2006 Nov 30.
• [26] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [27] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [28] Effect of prenatal arsenic exposure on DNA methylation and leukocyte subpopulations in cord blood. Epigenetics. 2014 May;9(5):774-82. doi: 10.4161/epi.28153. Epub 2014 Feb 13.
• [29] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [30] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [31] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [32] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [33] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [34] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [37] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [38] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.