Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKLIAWT)

DOT Name DNA replication licensing factor MCM6 (MCM6)
Synonyms EC 3.6.4.12; p105MCM
Gene Name MCM6
UniProt ID
MCM6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2KLQ; 2LE8; 6XTX; 6XTY; 7PFO; 7PLO; 7W1Y; 7W68; 8B9D
EC Number
3.6.4.12
Pfam ID
PF00493 ; PF18263 ; PF17855 ; PF14551 ; PF17207
Sequence
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
Function
Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
KEGG Pathway
D. replication (hsa03030 )
Cell cycle (hsa04110 )
Reactome Pathway
Unwinding of DNA (R-HSA-176974 )
Assembly of the pre-replicative complex (R-HSA-68867 )
Orc1 removal from chromatin (R-HSA-68949 )
Activation of the pre-replicative complex (R-HSA-68962 )
Switching of origins to a post-replicative state (R-HSA-69052 )
Activation of ATR in response to replication stress (R-HSA-176187 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
40 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of DNA replication licensing factor MCM6 (MCM6). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of DNA replication licensing factor MCM6 (MCM6). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of DNA replication licensing factor MCM6 (MCM6). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of DNA replication licensing factor MCM6 (MCM6). [4]
Estradiol DMUNTE3 Approved Estradiol increases the expression of DNA replication licensing factor MCM6 (MCM6). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of DNA replication licensing factor MCM6 (MCM6). [6]
Quercetin DM3NC4M Approved Quercetin decreases the expression of DNA replication licensing factor MCM6 (MCM6). [7]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of DNA replication licensing factor MCM6 (MCM6). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of DNA replication licensing factor MCM6 (MCM6). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of DNA replication licensing factor MCM6 (MCM6). [10]
Testosterone DM7HUNW Approved Testosterone decreases the expression of DNA replication licensing factor MCM6 (MCM6). [10]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of DNA replication licensing factor MCM6 (MCM6). [11]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of DNA replication licensing factor MCM6 (MCM6). [12]
Marinol DM70IK5 Approved Marinol decreases the expression of DNA replication licensing factor MCM6 (MCM6). [13]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of DNA replication licensing factor MCM6 (MCM6). [14]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of DNA replication licensing factor MCM6 (MCM6). [15]
Menadione DMSJDTY Approved Menadione affects the expression of DNA replication licensing factor MCM6 (MCM6). [16]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of DNA replication licensing factor MCM6 (MCM6). [17]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of DNA replication licensing factor MCM6 (MCM6). [18]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of DNA replication licensing factor MCM6 (MCM6). [19]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of DNA replication licensing factor MCM6 (MCM6). [20]
Etoposide DMNH3PG Approved Etoposide decreases the expression of DNA replication licensing factor MCM6 (MCM6). [21]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of DNA replication licensing factor MCM6 (MCM6). [22]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of DNA replication licensing factor MCM6 (MCM6). [23]
Atropine DMEN6X7 Approved Atropine increases the expression of DNA replication licensing factor MCM6 (MCM6). [24]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of DNA replication licensing factor MCM6 (MCM6). [25]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of DNA replication licensing factor MCM6 (MCM6). [26]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of DNA replication licensing factor MCM6 (MCM6). [5]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of DNA replication licensing factor MCM6 (MCM6). [27]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of DNA replication licensing factor MCM6 (MCM6). [21]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of DNA replication licensing factor MCM6 (MCM6). [28]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of DNA replication licensing factor MCM6 (MCM6). [30]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of DNA replication licensing factor MCM6 (MCM6). [32]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of DNA replication licensing factor MCM6 (MCM6). [33]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of DNA replication licensing factor MCM6 (MCM6). [34]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of DNA replication licensing factor MCM6 (MCM6). [35]
Lithium chloride DMHYLQ2 Investigative Lithium chloride decreases the expression of DNA replication licensing factor MCM6 (MCM6). [36]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE DMNQL17 Investigative 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of DNA replication licensing factor MCM6 (MCM6). [21]
PD98059 DMZC90M Investigative PD98059 affects the expression of DNA replication licensing factor MCM6 (MCM6). [37]
GW-3965 DMG60ET Investigative GW-3965 decreases the expression of DNA replication licensing factor MCM6 (MCM6). [38]
------------------------------------------------------------------------------------
⏷ Show the Full List of 40 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of DNA replication licensing factor MCM6 (MCM6). [29]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of DNA replication licensing factor MCM6 (MCM6). [31]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of DNA replication licensing factor MCM6 (MCM6). [31]
------------------------------------------------------------------------------------

References

1 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
8 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
9 Proteomic and functional analyses reveal a dual molecular mechanism underlying arsenic-induced apoptosis in human multiple myeloma cells. J Proteome Res. 2009 Jun;8(6):3006-19.
10 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
11 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
12 Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
13 JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
14 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
15 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
16 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
17 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
18 Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
19 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
20 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
21 Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
22 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
23 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
24 Gene expression signature of parathion-transformed human breast epithelial cells. Int J Mol Med. 2007 May;19(5):741-50.
25 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
26 Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
27 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
28 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
29 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
30 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
31 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
32 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
33 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
34 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
35 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
36 Lithium suppresses cell proliferation by interrupting E2F-DNA interaction and subsequently reducing S-phase gene expression in prostate cancer. Prostate. 2007 Jun 15;67(9):976-88. doi: 10.1002/pros.20586.
37 Expression of minichromosome maintenance proteins in vascular smooth muscle cells is ERK/MAPK dependent. Exp Cell Res. 2003 Oct 15;290(1):28-37. doi: 10.1016/s0014-4827(03)00311-2.
38 System analysis of cross-talk between nuclear receptors reveals an opposite regulation of the cell cycle by LXR and FXR in human HepaRG liver cells. PLoS One. 2019 Aug 22;14(8):e0220894. doi: 10.1371/journal.pone.0220894. eCollection 2019.