Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLHOXMQ)

DOT Name	Clathrin light chain A (CLTA)
Synonyms	Lca
Gene Name	CLTA
Related Disease	Blindness ( ) Adult lymphoma ( ) Advanced cancer ( ) Aortic valve stenosis ( ) Attention deficit hyperactivity disorder ( ) Breast cancer ( ) Breast carcinoma ( ) Cholestasis ( ) Chromosomal disorder ( ) Classic Hodgkin lymphoma ( ) Cone-rod dystrophy ( ) Cone-rod dystrophy 2 ( ) Congenital alveolar dysplasia ( ) Esophageal squamous cell carcinoma ( ) GNE myopathy ( ) Graves disease ( ) Leber congenital amaurosis 1 ( ) Leber congenital amaurosis 9 ( ) Melanoma ( ) Neuroblastoma ( ) Obesity ( ) Pediatric lymphoma ( ) Sialuria ( ) Thrombocytopenia ( ) Triple negative breast cancer ( ) Large cell lymphoma ( ) Neoplasm ( ) Lymphoma ( ) Malignant pleural mesothelioma ( ) Migraine disorder ( ) Retinitis pigmentosa ( ) Rheumatoid arthritis ( )
UniProt ID	CLCA_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	6E5N
Pfam ID	PF01086
Sequence	MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS LKQAPLVH
Function	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as a component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge.
KEGG Pathway	Lysosome (hsa04142 ) Endocytosis (hsa04144 ) Sy.ptic vesicle cycle (hsa04721 ) Endocrine and other factor-regulated calcium reabsorption (hsa04961 ) Huntington disease (hsa05016 ) Bacterial invasion of epithelial cells (hsa05100 )
Reactome Pathway	Retrograde neurotrophin signalling (R-HSA-177504 ) Gap junction degradation (R-HSA-190873 ) Formation of annular gap junctions (R-HSA-196025 ) MHC class II antigen presentation (R-HSA-2132295 ) EPH-ephrin mediated repulsion of cells (R-HSA-3928665 ) Lysosome Vesicle Biogenesis (R-HSA-432720 ) Recycling pathway of L1 (R-HSA-437239 ) WNT5A-dependent internalization of FZD4 (R-HSA-5099900 ) WNT5A-dependent internalization of FZD2, FZD5 and ROR2 (R-HSA-5140745 ) Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 ) Clathrin-mediated endocytosis (R-HSA-8856828 ) VLDLR internalisation and degradation (R-HSA-8866427 ) LDL clearance (R-HSA-8964038 ) Entry of Influenza Virion into Host Cell via Endocytosis (R-HSA-168275 )

Molecular Interaction Atlas (MIA) of This DOT

32 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Blindness	DISTIM10	Definitive	Biomarker	[1]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Aortic valve stenosis	DISW7AQ9	Strong	Genetic Variation	[4]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[5]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[6]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[6]
Cholestasis	DISDJJWE	Strong	Biomarker	[7]
Chromosomal disorder	DISM5BB5	Strong	Genetic Variation	[8]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[9]
Cone-rod dystrophy	DISY9RWN	Strong	Biomarker	[10]
Cone-rod dystrophy 2	DISX2RWY	Strong	Biomarker	[10]
Congenital alveolar dysplasia	DIS1IYUN	Strong	Genetic Variation	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[12]
GNE myopathy	DIS73X4W	Strong	Genetic Variation	[13]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[14]
Leber congenital amaurosis 1	DISY2B33	Strong	Biomarker	[2]
Leber congenital amaurosis 9	DIS35YGW	Strong	Biomarker	[10]
Melanoma	DIS1RRCY	Strong	Altered Expression	[15]
Neuroblastoma	DISVZBI4	Strong	Genetic Variation	[16]
Obesity	DIS47Y1K	Strong	Genetic Variation	[4]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[2]
Sialuria	DISK9T5J	Strong	Genetic Variation	[13]
Thrombocytopenia	DISU61YW	Strong	Genetic Variation	[17]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[18]
Large cell lymphoma	DISYZHCP	moderate	Biomarker	[19]
Neoplasm	DISZKGEW	moderate	Biomarker	[18]
Lymphoma	DISN6V4S	Limited	Biomarker	[2]
Malignant pleural mesothelioma	DIST2R60	Limited	Altered Expression	[20]
Migraine disorder	DISFCQTG	Limited	Biomarker	[21]
Retinitis pigmentosa	DISCGPY8	Limited	Genetic Variation	[11]
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[22]
------------------------------------------------------------------------------------


⏷ Show the Full List of 32 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Clathrin light chain A (CLTA).	[23]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Clathrin light chain A (CLTA).	[24]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Clathrin light chain A (CLTA).	[25]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid increases the expression of Clathrin light chain A (CLTA).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Clathrin light chain A (CLTA).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Clathrin light chain A (CLTA).	[29]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol affects the secretion of Clathrin light chain A (CLTA).	[27]
------------------------------------------------------------------------------------

References

1	Attitudes of people with inherited retinal conditions toward gene editing technology.Mol Genet Genomic Med. 2019 Jul;7(7):e00803. doi: 10.1002/mgg3.803. Epub 2019 Jun 12.
2	Cutaneous spindled follicle center cell lymphoma with abundant mucin: A diagnostic pitfall.J Cutan Pathol. 2020 Apr;47(4):394-397. doi: 10.1111/cup.13609. Epub 2019 Nov 27.
3	Proteomic characterization of early lung response to breast cancer metastasis in mice.Exp Mol Pathol. 2019 Apr;107:129-140. doi: 10.1016/j.yexmp.2019.02.001. Epub 2019 Feb 11.
4	Thromboembolic Occlusion of the Left Coronary Artery During Transcatheter Aortic Valve Implantation.J Invasive Cardiol. 2018 Feb;30(2):E21-E22.
5	A pilot trial of l-carnitine in patients with traumatic brain injury: Effects on biomarkers of injury.J Crit Care. 2018 Jun;45:128-132. doi: 10.1016/j.jcrc.2018.01.029. Epub 2018 Feb 9.
6	Lithocholic acid, a bacterial metabolite reduces breast cancer cell proliferation and aggressiveness.Biochim Biophys Acta Bioenerg. 2018 Sep;1859(9):958-974. doi: 10.1016/j.bbabio.2018.04.002. Epub 2018 Apr 13.
7	Tanshinone IIA exerts protective effects in a LCA-induced cholestatic liver model associated with participation of pregnane X receptor.J Ethnopharmacol. 2015 Apr 22;164:357-67. doi: 10.1016/j.jep.2015.01.047. Epub 2015 Feb 7.
8	The synergic effects of CTLA-4/Foxp3-related genotypes and chromosomal aberrations on the risk of recurrent spontaneous abortion among a Chinese Han population.J Hum Genet. 2018 May;63(5):579-587. doi: 10.1038/s10038-018-0414-2. Epub 2018 Feb 23.
9	Monomorphic lymphomas arising in patients with Hodgkin's disease. Correlation of morphologic, immunophenotypic, and molecular genetic findings in 12 cases.Am J Pathol. 1990 Jan;136(1):81-94.
10	Genome-wide linkage and sequence analysis challenge CCDC66 as a human retinal dystrophy candidate gene and support a distinct NMNAT1-related fundus phenotype. Clin Genet. 2018 Jan;93(1):149-154. doi: 10.1111/cge.13022. Epub 2017 May 9.
11	PRPH2/RDS and ROM-1: Historical context, current views and future considerations.Prog Retin Eye Res. 2016 May;52:47-63. doi: 10.1016/j.preteyeres.2015.12.002. Epub 2016 Jan 8.
12	Targeting CD47 Enhances the Efficacy of Anti-PD-1 and CTLA-4 in an Esophageal Squamous Cell Cancer Preclinical Model.Oncol Res. 2017 Nov 2;25(9):1579-1587. doi: 10.3727/096504017X14900505020895. Epub 2017 Mar 23.
13	Missing genetic variations in GNE myopathy: rearrangement hotspots encompassing 5'UTR and founder allele.J Hum Genet. 2017 Feb;62(2):159-166. doi: 10.1038/jhg.2016.134. Epub 2016 Nov 10.
14	The associations between the polymorphisms in the CTLA-4 gene and the risk of Graves' disease in the Chinese population.BMC Med Genet. 2013 Apr 19;14:46. doi: 10.1186/1471-2350-14-46.
15	Identification of robust reference genes for studies of gene expression in FFPE melanoma samples and melanoma cell lines.Melanoma Res. 2020 Feb;30(1):26-38. doi: 10.1097/CMR.0000000000000644.
16	Rhabdomyosarcoma of the head and neck in children.Oral Oncol. 2002 Jul;38(5):450-9. doi: 10.1016/s1368-8375(01)00105-1.
17	Diagnostic high-throughput sequencing of 2396 patients with bleeding, thrombotic, and platelet disorders.Blood. 2019 Dec 5;134(23):2082-2091. doi: 10.1182/blood.2018891192.
18	MiR-210 Is Overexpressed in Tumor-infiltrating Plasma Cells in Triple-negative Breast Cancer.J Histochem Cytochem. 2020 Jan;68(1):25-32. doi: 10.1369/0022155419892965. Epub 2019 Dec 1.
19	Relationship between Epstein-Barr virus and lymphoepithelioma-like carcinoma of the lung: a clinicopathologic study of 6 cases and review of the literature.Hum Pathol. 2001 Aug;32(8):863-72. doi: 10.1053/hupa.2001.26457.
20	CXCR4+FOXP3+CD25+ lymphocytes accumulate in CXCL12-expressing malignant pleural mesothelioma.Int J Immunopathol Pharmacol. 2009 Jan-Mar;22(1):43-51. doi: 10.1177/039463200902200106.
21	A genome-wide linkage scan provides evidence for both new and previously reported loci influencing common migraine.Am J Med Genet B Neuropsychiatr Genet. 2008 Oct 5;147B(7):1186-95. doi: 10.1002/ajmg.b.30749.
22	Association of the CTLA-4 gene with rheumatoid arthritis in Chinese Han population.Eur J Hum Genet. 2005 Jul;13(7):823-8. doi: 10.1038/sj.ejhg.5201423.
23	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
24	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
25	Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
26	Antineoplastic effects of gamma linolenic Acid on hepatocellular carcinoma cell lines. J Clin Biochem Nutr. 2010 Jul;47(1):81-90.
27	Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
28	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
29	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.