Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLKU5I2)

DOT Name Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5)
Gene Name C1QTNF5
Related Disease
Arteriosclerosis ( )
Atherosclerosis ( )
Coronary heart disease ( )
Late-onset retinal degeneration ( )
Age-related macular degeneration ( )
Atrial fibrillation ( )
Disorder of glycogen metabolism ( )
Fatty liver disease ( )
Metabolic disorder ( )
Myocardial infarction ( )
Obesity ( )
Proliferative diabetic retinopathy ( )
Retinal degeneration ( )
Retinopathy ( )
X-linked reticulate pigmentary disorder ( )
Glycogen storage disease type II ( )
Doyne honeycomb retinal dystrophy ( )
Macular degeneration ( )
Non-insulin dependent diabetes ( )
Prediabetes syndrome ( )
Sorsby fundus dystrophy ( )
Type-1/2 diabetes ( )
Vitelliform macular dystrophy ( )
UniProt ID
C1QT5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4F3J; 4NN0
Pfam ID
PF00386 ; PF01391
Sequence
MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPG
APGEKGEGGRPGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSD
APLPFDRVLVNEQGHYDAVTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQ
FFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSP
VFA

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Arteriosclerosis DISK5QGC Definitive Biomarker [1]
Atherosclerosis DISMN9J3 Definitive Biomarker [1]
Coronary heart disease DIS5OIP1 Definitive Altered Expression [1]
Late-onset retinal degeneration DIST9GP4 Definitive Autosomal dominant [2]
Age-related macular degeneration DIS0XS2C Strong Genetic Variation [3]
Atrial fibrillation DIS15W6U Strong Biomarker [4]
Disorder of glycogen metabolism DISYGNOB Strong Genetic Variation [5]
Fatty liver disease DIS485QZ Strong Genetic Variation [6]
Metabolic disorder DIS71G5H Strong Biomarker [7]
Myocardial infarction DIS655KI Strong Biomarker [8]
Obesity DIS47Y1K Strong Biomarker [9]
Proliferative diabetic retinopathy DISQZ13G Strong Biomarker [10]
Retinal degeneration DISM1JHQ Strong Biomarker [11]
Retinopathy DISB4B0F Strong Biomarker [12]
X-linked reticulate pigmentary disorder DIS0RB5A Strong Biomarker [10]
Glycogen storage disease type II DISXZPBC moderate Genetic Variation [3]
Doyne honeycomb retinal dystrophy DISKFNCT Limited Genetic Variation [13]
Macular degeneration DISLKKHD Limited Genetic Variation [14]
Non-insulin dependent diabetes DISK1O5Z Limited Altered Expression [15]
Prediabetes syndrome DISH2I53 Limited Biomarker [16]
Sorsby fundus dystrophy DISFVBJE Limited Genetic Variation [13]
Type-1/2 diabetes DISIUHAP Limited Biomarker [9]
Vitelliform macular dystrophy DISEFYYN Limited Genetic Variation [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 23 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5). [17]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5). [18]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Complement C1q tumor necrosis factor-related protein 5 (C1QTNF5). [19]
------------------------------------------------------------------------------------

References

1 CTRP5 promotes transcytosis and oxidative modification of low-density lipoprotein and the development of atherosclerosis.Atherosclerosis. 2018 Nov;278:197-209. doi: 10.1016/j.atherosclerosis.2018.09.037. Epub 2018 Sep 28.
2 Mutation in a short-chain collagen gene, CTRP5, results in extracellular deposit formation in late-onset retinal degeneration: a genetic model for age-related macular degeneration. Hum Mol Genet. 2003 Oct 15;12(20):2657-67. doi: 10.1093/hmg/ddg289. Epub 2003 Aug 27.
3 Co-Expression of Wild-Type and Mutant S163R C1QTNF5 in Retinal Pigment Epithelium.Adv Exp Med Biol. 2018;1074:61-66. doi: 10.1007/978-3-319-75402-4_8.
4 Presence of rd8 mutation does not alter the ocular phenotype of late-onset retinal degeneration mouse model.Mol Vis. 2015 Mar 13;21:273-84. eCollection 2015.
5 Co-inheritance of the membrane frizzled-related protein ocular phenotype and glycogen storage disease type Ib.Ophthalmic Genet. 2017 Dec;38(6):544-548. doi: 10.1080/13816810.2017.1323340. Epub 2017 May 16.
6 Myonectin deletion promotes adipose fat storage and reduces liver steatosis.FASEB J. 2019 Jul;33(7):8666-8687. doi: 10.1096/fj.201900520R. Epub 2019 Apr 19.
7 The novel adipokine CTRP5 is a negative regulator of white adipose tissue browning.Biochem Biophys Res Commun. 2019 Mar 12;510(3):388-394. doi: 10.1016/j.bbrc.2019.01.111. Epub 2019 Feb 1.
8 Myonectin Is an Exercise-Induced Myokine That Protects the Heart From Ischemia-Reperfusion Injury.Circ Res. 2018 Dec 7;123(12):1326-1338. doi: 10.1161/CIRCRESAHA.118.313777.
9 Circulating complement-1q tumor necrosis factor--related protein isoform5 levels are low in type2 diabetes patients and reduced by dapagliflozin.J Diabetes Investig. 2020 Jan;11(1):88-95. doi: 10.1111/jdi.13069. Epub 2019 Jun 6.
10 CTRP3 is a novel biomarker for diabetic retinopathy and inhibits HGHL-induced VCAM-1 expression in an AMPK-dependent manner.PLoS One. 2017 Jun 20;12(6):e0178253. doi: 10.1371/journal.pone.0178253. eCollection 2017.
11 Biochemical characterisation of the C1QTNF5 gene associated with late-onset retinal degeneration. A genetic model of age-related macular degeneration.Adv Exp Med Biol. 2006;572:41-8. doi: 10.1007/0-387-32442-9_7.
12 Phenotypic findings in C1QTNF5 retinopathy (late-onset retinal degeneration).Acta Ophthalmol. 2013 May;91(3):e191-5. doi: 10.1111/aos.12010. Epub 2013 Jan 7.
13 Molecular diagnostic testing by eyeGENE: analysis of patients with hereditary retinal dystrophy phenotypes involving central vision loss.Invest Ophthalmol Vis Sci. 2014 Jul 31;55(9):5510-21. doi: 10.1167/iovs.14-14359.
14 The macular degeneration-linked C1QTNF5 (S163) mutation causes higher-order structural rearrangements.J Struct Biol. 2014 Apr;186(1):86-94. doi: 10.1016/j.jsb.2014.02.001. Epub 2014 Feb 12.
15 Circulating Serum Myonectin Levels in Obesity and Type 2 Diabetes Mellitus.Exp Clin Endocrinol Diabetes. 2021 Jul;129(7):528-534. doi: 10.1055/a-0896-8548. Epub 2019 Jul 24.
16 Myonectin Predicts the Development of Type 2 Diabetes.J Clin Endocrinol Metab. 2018 Jan 1;103(1):139-147. doi: 10.1210/jc.2017-01604.
17 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
18 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
19 Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.