Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNKPQ22)

DOT Name	G1/S-specific cyclin-D3 (CCND3)
Gene Name	CCND3
UniProt ID	CCND3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3G33; 7SJ3
Pfam ID	PF02984 ; PF00134
Sequence	MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Function	Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Shows transcriptional coactivator activity with ATF5 independently of CDK4.
KEGG Pathway	Cell cycle (hsa04110 ) p53 sig.ling pathway (hsa04115 ) PI3K-Akt sig.ling pathway (hsa04151 ) Cellular senescence (hsa04218 ) Wnt sig.ling pathway (hsa04310 ) Hippo sig.ling pathway (hsa04390 ) Focal adhesion (hsa04510 ) JAK-STAT sig.ling pathway (hsa04630 ) Measles (hsa05162 ) Influenza A (hsa05164 ) Human papillomavirus infection (hsa05165 ) Human T-cell leukemia virus 1 infection (hsa05166 ) Epstein-Barr virus infection (hsa05169 ) Pathways in cancer (hsa05200 ) Viral carcinogenesis (hsa05203 ) Chemical carcinogenesis - receptor activation (hsa05207 )
Reactome Pathway	MAPK6/MAPK4 signaling (R-HSA-5687128 ) Cyclin D associated events in G1 (R-HSA-69231 ) Regulation of RUNX1 Expression and Activity (R-HSA-8934593 ) Defective binding of RB1 mutants to E2F1,(E2F2, E2F3) (R-HSA-9661069 ) Drug-mediated inhibition of CDK4/CDK6 activity (R-HSA-9754119 ) Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

63 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of G1/S-specific cyclin-D3 (CCND3).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of G1/S-specific cyclin-D3 (CCND3).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[7]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of G1/S-specific cyclin-D3 (CCND3).	[8]
Marinol	DM70IK5	Approved	Marinol decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[9]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of G1/S-specific cyclin-D3 (CCND3).	[10]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[11]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[12]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[13]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[14]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[14]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[15]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[16]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of G1/S-specific cyclin-D3 (CCND3).	[8]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[17]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[18]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[19]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of G1/S-specific cyclin-D3 (CCND3).	[20]
Palbociclib	DMD7L94	Approved	Palbociclib increases the expression of G1/S-specific cyclin-D3 (CCND3).	[21]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[14]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea increases the expression of G1/S-specific cyclin-D3 (CCND3).	[22]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[23]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[24]
Gefitinib	DM15F0X	Approved	Gefitinib decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[18]
Imatinib	DM7RJXL	Approved	Imatinib decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[25]
Lovastatin	DM9OZWQ	Approved	Lovastatin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[26]
Ximelegatran	DMU8ANS	Approved	Ximelegatran decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[27]
Nelfinavir mesylate	DMFX6G8	Approved	Nelfinavir mesylate decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[28]
Dronedarone	DMA8FS5	Approved	Dronedarone decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[29]
Furazolidone	DM3P6V7	Approved	Furazolidone increases the expression of G1/S-specific cyclin-D3 (CCND3).	[30]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of G1/S-specific cyclin-D3 (CCND3).	[31]
Silymarin	DMXBYQR	Phase 4	Silymarin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[32]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[33]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[34]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[35]
Avastin+/-Tarceva	DMA86FL	Phase 3	Avastin+/-Tarceva decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[36]
Thymoquinone	DMVDTR2	Phase 2/3	Thymoquinone decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[37]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of G1/S-specific cyclin-D3 (CCND3).	[38]
URSOLIC ACID	DM4SOAW	Phase 2	URSOLIC ACID decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[39]
2-hydroxyoleic acid	DMCLKA4	Phase 1/2	2-hydroxyoleic acid decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[40]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[42]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[43]
AMEP	DMFELMQ	Phase 1	AMEP decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[44]
AMG 900	DMASGXJ	Phase 1	AMG 900 decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[45]
Steroid derivative 1	DMB0NVQ	Patented	Steroid derivative 1 decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[46]
LG100268	DM41RK2	Discontinued in Phase 1	LG100268 decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[14]
Acteoside	DM0YHKB	Terminated	Acteoside decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[47]
AG490	DM3WKO5	Terminated	AG490 decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of G1/S-specific cyclin-D3 (CCND3).	[34]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of G1/S-specific cyclin-D3 (CCND3).	[49]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of G1/S-specific cyclin-D3 (CCND3).	[50]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[51]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[52]
U0126	DM31OGF	Investigative	U0126 decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[43]
15-deoxy-Delta(12, 14)-prostaglandin J(2)	DM8VUX3	Investigative	15-deoxy-Delta(12, 14)-prostaglandin J(2) decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[14]
USNIC ACID	DMGOURX	Investigative	USNIC ACID decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[53]
TTNPB	DMSABD0	Investigative	TTNPB decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[19]
tryptanthrin	DMTRYCI	Investigative	tryptanthrin decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[54]
Amarylline	DML9W2V	Investigative	Amarylline decreases the expression of G1/S-specific cyclin-D3 (CCND3).	[55]
------------------------------------------------------------------------------------


⏷ Show the Full List of 63 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of G1/S-specific cyclin-D3 (CCND3).	[41]
------------------------------------------------------------------------------------

References

1	Effects of valproic acid and levetiracetam on viability and cell cycle regulatory genes expression in the OVCAR-3 cell line. Pharmacol Rep. 2012;64(1):157-65. doi: 10.1016/s1734-1140(12)70742-9.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Retinoid targeting of different D-type cyclins through distinct chemopreventive mechanisms. Cancer Res. 2005 Jul 15;65(14):6476-83. doi: 10.1158/0008-5472.CAN-05-0370.
4	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5	Estrogen-induced G1/S transition of G0-arrested estrogen-dependent breast cancer cells is regulated by mitochondrial oxidant signaling. Oncogene. 2005 Jul 21;24(31):4883-93. doi: 10.1038/sj.onc.1208667.
6	Inhibition of prostate cancer cell colony formation by the flavonoid quercetin correlates with modulation of specific regulatory genes. Clin Diagn Lab Immunol. 2004 Jan;11(1):63-9. doi: 10.1128/cdli.11.1.63-69.2004.
7	Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
8	Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
9	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
10	Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery. Mol Cancer. 2006 May 18;5:20. doi: 10.1186/1476-4598-5-20.
11	Impact of extracellular folate levels on global gene expression. Mol Pharmacol. 2001 Dec;60(6):1288-95. doi: 10.1124/mol.60.6.1288.
12	Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
13	Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
14	Thiazolidinediones inhibit proliferation of microvascular and macrovascular cells by a PPARgamma-independent mechanism. Diabetologia. 2005 Mar;48(3):586-94. doi: 10.1007/s00125-005-1672-z. Epub 2005 Feb 24.
15	Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
16	DNA array analysis of the effects of aspirin on colon cancer cells: involvement of Rac1. Carcinogenesis. 2004 Jul;25(7):1293-8.
17	Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
18	Dasatinib (BMS-354825) selectively induces apoptosis in lung cancer cells dependent on epidermal growth factor receptor signaling for survival. Cancer Res. 2006 Jun 1;66(11):5542-8. doi: 10.1158/0008-5472.CAN-05-4620.
19	Receptor-selective retinoids inhibit the growth of normal and malignant breast cells by inducing G1 cell cycle blockade. Breast Cancer Res Treat. 2006 Mar;96(2):147-57. doi: 10.1007/s10549-005-9071-1. Epub 2005 Nov 5.
20	Daunorubicin-induced variations in gene transcription: commitment to proliferation arrest, senescence and apoptosis. Biochem J. 2003 Jun 15;372(Pt 3):703-11. doi: 10.1042/BJ20021950.
21	Therapeutic CDK4/6 inhibition in breast cancer: key mechanisms of response and failure. Oncogene. 2010 Jul 15;29(28):4018-32. doi: 10.1038/onc.2010.154. Epub 2010 May 17.
22	The potential of iron chelators of the pyridoxal isonicotinoyl hydrazone class as effective antiproliferative agents, IV: The mechanisms involved in inhibiting cell-cycle progression. Blood. 2001 Aug 1;98(3):842-50. doi: 10.1182/blood.v98.3.842.
23	Coadministration of sorafenib with rottlerin potently inhibits cell proliferation and migration in human malignant glioma cells. J Pharmacol Exp Ther. 2006 Dec;319(3):1070-80. doi: 10.1124/jpet.106.108621. Epub 2006 Sep 7.
24	Mechanism of apoptotic effects induced selectively by ursodeoxycholic acid on human hepatoma cell lines. World J Gastroenterol. 2007 Mar 21;13(11):1652-8. doi: 10.3748/wjg.v13.i11.1652.
25	A systems biology understanding of the synergistic effects of arsenic sulfide and Imatinib in BCR/ABL-associated leukemia. Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3378-83.
26	Lovastatin inhibits G1/S transition of normal human B-lymphocytes independent of apoptosis. Exp Cell Res. 1999 Oct 10;252(1):144-53. doi: 10.1006/excr.1999.4608.
27	ATPR induces acute promyelocytic leukemia cells differentiation and growth arrest by blockade of SHP2/Rho/ROCK1 pathway. Toxicol Appl Pharmacol. 2020 Jul 15;399:115053. doi: 10.1016/j.taap.2020.115053. Epub 2020 May 15.
28	Nelfinavir induces the unfolded protein response in ovarian cancer cells, resulting in ER vacuolization, cell cycle retardation and apoptosis. Cancer Biol Ther. 2009 Feb;8(3):226-32. doi: 10.4161/cbt.8.3.7339. Epub 2009 Feb 3.
29	The role of hepatic cytochrome P450s in the cytotoxicity of dronedarone. Arch Toxicol. 2018 Jun;92(6):1969-1981. doi: 10.1007/s00204-018-2196-x. Epub 2018 Apr 3.
30	Involvement of the p38 MAPK signaling pathway in S-phase cell-cycle arrest induced by Furazolidone in human hepatoma G2 cells. J Appl Toxicol. 2013 Dec;33(12):1500-5. doi: 10.1002/jat.2829. Epub 2012 Oct 30.
31	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
32	Identifying the differential effects of silymarin constituents on cell growth and cell cycle regulatory molecules in human prostate cancer cells. Int J Cancer. 2008 Jul 1;123(1):41-50. doi: 10.1002/ijc.23485.
33	Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
34	Bisphenol-A-induced inactivation of the p53 axis underlying deregulation of proliferation kinetics, and cell death in non-malignant human breast epithelial cells. Carcinogenesis. 2013 Mar;34(3):703-12. doi: 10.1093/carcin/bgs379. Epub 2012 Dec 7.
35	Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
36	Juglone-ascorbic acid synergy inhibits metastasis and induces apoptotic cell death in poorly differentiated thyroid carcinoma by perturbing SOD and catalase activities. J Biochem Mol Toxicol. 2018 Sep;32(9):e22176. doi: 10.1002/jbt.22176. Epub 2018 Jul 10.
37	Thymoquinone suppresses invasion and metastasis in bladder cancer cells by reversing EMT through the Wnt/-catenin signaling pathway. Chem Biol Interact. 2020 Apr 1;320:109022. doi: 10.1016/j.cbi.2020.109022. Epub 2020 Feb 27.
38	Retinoic acid stimulates the cell cycle machinery in normal T cells: involvement of retinoic acid receptor-mediated IL-2 secretion. J Immunol. 2002 Nov 15;169(10):5555-63. doi: 10.4049/jimmunol.169.10.5555.
39	Ursolic acid induces autophagy in U87MG cells via ROS-dependent endoplasmic reticulum stress. Chem Biol Interact. 2014 Jul 25;218:28-41. doi: 10.1016/j.cbi.2014.04.017. Epub 2014 May 5.
40	The repression of E2F-1 is critical for the activity of Minerval against cancer. J Pharmacol Exp Ther. 2005 Oct;315(1):466-74. doi: 10.1124/jpet.105.088716. Epub 2005 Jul 18.
41	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
42	Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
43	Differentiation-inducing factor-1-induced growth arrest of K562 leukemia cells involves the reduction of ERK1/2 activity. Eur J Pharmacol. 2004 Feb 6;485(1-3):21-9. doi: 10.1016/j.ejphar.2003.11.041.
44	Glyphosate and AMPA inhibit cancer cell growth through inhibiting intracellular glycine synthesis. Drug Des Devel Ther. 2013 Jul 24;7:635-43. doi: 10.2147/DDDT.S49197. eCollection 2013.
45	AMG900 as novel inhibitor of the translationally controlled tumor protein. Chem Biol Interact. 2021 Jan 25;334:109349. doi: 10.1016/j.cbi.2020.109349. Epub 2020 Nov 28.
46	2-methoxyestradiol induces mitotic arrest, apoptosis, and synergistic cytotoxicity with arsenic trioxide in human urothelial carcinoma cells. PLoS One. 2013 Aug 13;8(8):e68703. doi: 10.1371/journal.pone.0068703. eCollection 2013.
47	Acteoside inhibits human promyelocytic HL-60 leukemia cell proliferation via inducing cell cycle arrest at G0/G1 phase and differentiation into monocyte. Carcinogenesis. 2007 Sep;28(9):1928-36. doi: 10.1093/carcin/bgm126. Epub 2007 Jul 18.
48	Thymoquinone induces oxidative stress-mediated apoptosis through downregulation of Jak2/STAT3 signaling pathway in human melanoma cells. Food Chem Toxicol. 2021 Nov;157:112604. doi: 10.1016/j.fct.2021.112604. Epub 2021 Oct 7.
49	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
50	Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
51	Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
52	Rapamycin inhibits human renal epithelial cell proliferation: effect on cyclin D3 mRNA expression and stability. Kidney Int. 2005 Jun;67(6):2422-33. doi: 10.1111/j.1523-1755.2005.00350.x.
53	Activation of the Nrf2 signaling pathway in usnic acid-induced toxicity in HepG2 cells. Arch Toxicol. 2017 Mar;91(3):1293-1307.
54	Tryptanthrin induces growth inhibition and neuronal differentiation in the human neuroblastoma LA-N-1 cells. Chem Biol Interact. 2013 Apr 25;203(2):512-21. doi: 10.1016/j.cbi.2013.03.001. Epub 2013 Mar 13.
55	Lycorine hydrochloride selectively inhibits human ovarian cancer cell proliferation and tumor neovascularization with very low toxicity. Toxicol Lett. 2013 Apr 12;218(2):174-85. doi: 10.1016/j.toxlet.2013.01.018. Epub 2013 Jan 31.