Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRA2S7B)

• DOT Name: Liprin-beta-1 (PPFIBP1)
• Synonyms: Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 1; PTPRF-interacting protein-binding protein 1; hSGT2
• Gene Name: PPFIBP1
• Related Disease:
  Chondrosarcoma
  Neurodevelopmental disorder with seizures, microcephaly, and brain abnormalities
• UniProt ID: LIPB1_HUMAN
• Pfam ID: PF00536 ; PF07647
• Sequence:
  MMSDASDMLAAALEQMDGIIAGSKALEYSNGIFDCQSPTSPFMGSLRALHLVEDLRGLLE
  MMETDEKEGLRCQIPDSTAETLVEWLQSQMTNGHLPGNGDVYQERLARLENDKESLVLQV
  SVLTDQVEAQGEKIRDLEFCLEEHREKVNATEEMLQQELLSRTSLETQKLDLMAEISNLK
  LKLTAVEKDRLDYEDKFRDTEGLIQEINDLRLKVSEMDSERLQYEKKLKSTKSLMAKLSS
  MKIKVGQMQYEKQRMEQKWESLKDELASLKEQLEEKESEVKRLQEKLVCKMKGEGVEIVD
  RDIEVQKMKKAVESLMAANEEKDRKIEDLRQCLNRYKKMQDTVVLAQGKDGEYEELLNSS
  SISSLLDAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSME
  TSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKE
  TIQKTSEDRAPAESRPFGTLPPRPPGQDTSMDDNPFGTRKVRSSFGRGFFKIKSNKRTAS
  APNLAETEKETAEHLDLAGASSRPKDSQRNSPFQIPPPSPDSKKKSRGIMKLFGKLRRSQ
  STTFNPDDMSEPEFKRGGTRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCNWLMEQG
  LGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHGKLD
  FNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLR
  INNFEPNCLRRRPSDENTIAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVL
  EPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKV
  KPKKLAFSNFGNLRKKKQEDGEEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLE
  QMEDSEGTVRQIGAFSEGINNLTHMLKEDDMFKDFAARSPSASITDEDSNV
• Function: May regulate the disassembly of focal adhesions. Did not bind receptor-like tyrosine phosphatases type 2A.
• Tissue Specificity: Widely expressed. Absent in liver.
• Reactome Pathway:
  Signaling by ALK fusions and activated point mutants (R-HSA-9725370)
  Receptor-type tyrosine-protein phosphatases (R-HSA-388844)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chondrosarcoma	DIS4I7JB	Strong	Biomarker	[1]
Neurodevelopmental disorder with seizures, microcephaly, and brain abnormalities	DISZCJH6	Strong	Autosomal recessive	[2]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Liprin-beta-1 (PPFIBP1).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Liprin-beta-1 (PPFIBP1).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Liprin-beta-1 (PPFIBP1).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Liprin-beta-1 (PPFIBP1).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Liprin-beta-1 (PPFIBP1).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Liprin-beta-1 (PPFIBP1).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Liprin-beta-1 (PPFIBP1).	[8]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Liprin-beta-1 (PPFIBP1).	[9]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Liprin-beta-1 (PPFIBP1).	[10]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Liprin-beta-1 (PPFIBP1).	[11]
Marinol	DM70IK5	Approved	Marinol increases the expression of Liprin-beta-1 (PPFIBP1).	[12]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Liprin-beta-1 (PPFIBP1).	[13]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Liprin-beta-1 (PPFIBP1).	[14]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Liprin-beta-1 (PPFIBP1).	[15]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Liprin-beta-1 (PPFIBP1).	[16]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Liprin-beta-1 (PPFIBP1).	[4]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of Liprin-beta-1 (PPFIBP1).	[17]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Liprin-beta-1 (PPFIBP1).	[4]
Clodronate	DM9Y6X7	Approved	Clodronate affects the expression of Liprin-beta-1 (PPFIBP1).	[4]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Liprin-beta-1 (PPFIBP1).	[18]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Liprin-beta-1 (PPFIBP1).	[19]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Liprin-beta-1 (PPFIBP1).	[20]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Liprin-beta-1 (PPFIBP1).	[23]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Liprin-beta-1 (PPFIBP1).	[25]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Liprin-beta-1 (PPFIBP1).	[26]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Liprin-beta-1 (PPFIBP1).	[21]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Liprin-beta-1 (PPFIBP1).	[22]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Liprin-beta-1 (PPFIBP1).	[24]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Liprin-beta-1 (PPFIBP1).	[22]

References

• [1] Array-comparative genomic hybridization of central chondrosarcoma: identification of ribosomal protein S6 and cyclin-dependent kinase 4 as candidate target genes for genomic aberrations.Cancer. 2006 Jul 15;107(2):380-8. doi: 10.1002/cncr.22001.
• [2] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [5] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [10] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [11] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [12] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [13] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [14] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [15] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [16] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [17] Gene expression in human hippocampus from cocaine abusers identifies genes which regulate extracellular matrix remodeling. PLoS One. 2007 Nov 14;2(11):e1187. doi: 10.1371/journal.pone.0001187.
• [18] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [19] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [20] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [21] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [22] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [23] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [24] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [25] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [26] Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.