Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRE5V0C)

DOT Name Insulin-like growth factor-binding protein 5 (IGFBP5)
Synonyms IBP-5; IGF-binding protein 5; IGFBP-5
Gene Name IGFBP5
UniProt ID
IBP5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1BOE; 1H59; 7UFG
Pfam ID
PF00219 ; PF00086
Sequence
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Function
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
Tissue Specificity Osteosarcoma, and at lower levels in liver, kidney and brain.
Reactome Pathway
Post-translational protein phosphorylation (R-HSA-8957275 )
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )
BioCyc Pathway
MetaCyc:ENSG00000115461-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Insulin-like growth factor-binding protein 5 (IGFBP5). [1]
Arsenic DMTL2Y1 Approved Arsenic increases the methylation of Insulin-like growth factor-binding protein 5 (IGFBP5). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Insulin-like growth factor-binding protein 5 (IGFBP5). [34]
------------------------------------------------------------------------------------
45 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [2]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [3]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [5]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [9]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [10]
Triclosan DMZUR4N Approved Triclosan increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [11]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [12]
Marinol DM70IK5 Approved Marinol decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [13]
Progesterone DMUY35B Approved Progesterone decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [14]
Menadione DMSJDTY Approved Menadione increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [9]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [15]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [16]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [17]
Folic acid DMEMBJC Approved Folic acid affects the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [18]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [19]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [20]
Ethanol DMDRQZU Approved Ethanol increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [21]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [22]
Dasatinib DMJV2EK Approved Dasatinib increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [23]
Menthol DMG2KW7 Approved Menthol decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [24]
Amphotericin B DMTAJQE Approved Amphotericin B decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [4]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [25]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [4]
Mifepristone DMGZQEF Approved Mifepristone decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [26]
Hydrocortisone DMGEMB7 Approved Hydrocortisone decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [27]
Gentamicin DMKINJO Approved Gentamicin decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [4]
Estriol DMOEM2I Approved Estriol decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [5]
Isoflavone DM7U58J Phase 4 Isoflavone affects the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [28]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [29]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [30]
Fenretinide DMRD5SP Phase 3 Fenretinide decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [31]
Benzylpenicillin DMS9503 Phase 3 Benzylpenicillin decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [32]
ACYLINE DM9GRTK Phase 2 ACYLINE decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [33]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [35]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [36]
PMID28870136-Compound-48 DMPIM9L Patented PMID28870136-Compound-48 decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [37]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [38]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [39]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [29]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [40]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [41]
Thiorphan DM86LFB Investigative Thiorphan affects the expression of Insulin-like growth factor-binding protein 5 (IGFBP5). [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
3 RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
4 Effect of nephrotoxicants and hepatotoxicants on gene expression profile in human peripheral blood mononuclear cells. Biochem Biophys Res Commun. 2010 Oct 15;401(2):245-50. doi: 10.1016/j.bbrc.2010.09.039. Epub 2010 Sep 16.
5 Using a customized DNA microarray for expression profiling of the estrogen-responsive genes to evaluate estrogen activity among natural estrogens and industrial chemicals. Environ Health Perspect. 2004 May;112(7):773-81. doi: 10.1289/ehp.6753.
6 Identification of novel gene targets and putative regulators of arsenic-associated DNA methylation in human urothelial cells and bladder cancer. Chem Res Toxicol. 2015 Jun 15;28(6):1144-55. doi: 10.1021/tx500393y. Epub 2015 Jun 3.
7 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8 Curcumin reduces the expression of survivin, leading to enhancement of arsenic trioxide-induced apoptosis in myelodysplastic syndrome and leukemia stem-like cells. Oncol Rep. 2016 Sep;36(3):1233-42. doi: 10.3892/or.2016.4944. Epub 2016 Jul 15.
9 Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
10 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
13 JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
14 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
15 Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
16 Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
17 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
18 Folate deficiency in normal human fibroblasts leads to altered expression of genes primarily linked to cell signaling, the cytoskeleton and extracellular matrix. J Nutr Biochem. 2007 Aug;18(8):541-52. doi: 10.1016/j.jnutbio.2006.11.002. Epub 2007 Feb 22.
19 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
20 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
21 Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
22 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
23 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
24 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
25 The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
26 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
27 Ultradian cortisol pulsatility encodes a distinct, biologically important signal. PLoS One. 2011 Jan 18;6(1):e15766.
28 Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
29 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
30 Effects of resveratrol on gene expression in renal cell carcinoma. Cancer Biol Ther. 2004 Sep;3(9):882-8. doi: 10.4161/cbt.3.9.1056. Epub 2004 Sep 21.
31 Regulation of lipocalin-2 gene by the cancer chemopreventive retinoid 4-HPR. Int J Cancer. 2006 Oct 1;119(7):1599-606.
32 Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
33 Intraprostatic androgens and androgen-regulated gene expression persist after testosterone suppression: therapeutic implications for castration-resistant prostate cancer. Cancer Res. 2007 May 15;67(10):5033-41.
34 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
35 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
36 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
37 Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
38 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
39 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
40 Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
41 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
42 Neprilysin participates in skeletal muscle regeneration and is accumulated in abnormal muscle fibres of inclusion body myositis. J Neurochem. 2006 Feb;96(3):777-89.