Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSV0JL9)

DOT Name Killer cell immunoglobulin-like receptor 2DL5B (KIR2DL5B)
Synonyms CD158 antigen-like family member F2; Killer cell immunoglobulin-like receptor 2DLX; CD antigen CD158f2
Gene Name KIR2DL5B
Related Disease
Multiple sclerosis ( )
Acute myelogenous leukaemia ( )
Ankylosing spondylitis ( )
Breast cancer ( )
Breast carcinoma ( )
Cervical Intraepithelial neoplasia ( )
Coeliac disease ( )
Cytomegalovirus infection ( )
Hepatocellular carcinoma ( )
Inflammatory bowel disease ( )
Irritable bowel syndrome ( )
Non-hodgkin lymphoma ( )
Systemic lupus erythematosus ( )
Systemic sclerosis ( )
Head-neck squamous cell carcinoma ( )
Neurofibromatosis type 1 ( )
Small lymphocytic lymphoma ( )
Hepatitis C virus infection ( )
Rheumatoid arthritis ( )
Type-1 diabetes ( )
UniProt ID
KI2LB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00047
Sequence
MSLMVVSMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSL
YKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVDGTFQADF
PLGPATHGGTYTCFSSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQ
LDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTAL
SQNRVASSHVPAAGI
Function Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Multiple sclerosis DISB2WZI Definitive Biomarker [1]
Acute myelogenous leukaemia DISCSPTN Strong Genetic Variation [2]
Ankylosing spondylitis DISRC6IR Strong Genetic Variation [3]
Breast cancer DIS7DPX1 Strong Biomarker [4]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Cervical Intraepithelial neoplasia DISXP757 Strong Genetic Variation [5]
Coeliac disease DISIY60C Strong Genetic Variation [6]
Cytomegalovirus infection DISCEMGC Strong Genetic Variation [7]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [8]
Inflammatory bowel disease DISGN23E Strong Biomarker [9]
Irritable bowel syndrome DIS27206 Strong Biomarker [9]
Non-hodgkin lymphoma DISS2Y8A Strong Biomarker [10]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [11]
Systemic sclerosis DISF44L6 Strong Biomarker [12]
Head-neck squamous cell carcinoma DISF7P24 moderate Biomarker [13]
Neurofibromatosis type 1 DIS53JH9 moderate Biomarker [14]
Small lymphocytic lymphoma DIS30POX moderate Genetic Variation [15]
Hepatitis C virus infection DISQ0M8R Limited Altered Expression [8]
Rheumatoid arthritis DISTSB4J Limited Genetic Variation [16]
Type-1 diabetes DIS7HLUB Limited Biomarker [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Killer cell immunoglobulin-like receptor 2DL5B (KIR2DL5B). [18]
------------------------------------------------------------------------------------

References

1 Killer cell immunoglobulin-like receptor genes in Spanish multiple sclerosis patients.Mol Immunol. 2011 Sep;48(15-16):1896-902. doi: 10.1016/j.molimm.2011.05.018. Epub 2011 Jun 12.
2 Donor killer cell Ig-like receptor B haplotypes, recipient HLA-C1, and HLA-C mismatch enhance the clinical benefit of unrelated transplantation for acute myelogenous leukemia.J Immunol. 2014 May 15;192(10):4592-600. doi: 10.4049/jimmunol.1302517. Epub 2014 Apr 18.
3 Human Leukocyte Antigen C*12:02:02 and Killer Immunoglobulin-Like Receptor 2DL5 are Distinctly Associated with Ankylosing Spondylitis in the Taiwanese.Int J Mol Sci. 2017 Aug 16;18(8):1775. doi: 10.3390/ijms18081775.
4 The Killer Cell Ig-like Receptor 2DL4 Expression in Human Mast Cells and Its Potential Role in Breast Cancer Invasion.Cancer Immunol Res. 2015 Aug;3(8):871-80. doi: 10.1158/2326-6066.CIR-14-0199. Epub 2015 Mar 3.
5 A population-based cohort study of KIR genes and genotypes in relation to cervical intraepithelial neoplasia.Tissue Antigens. 2005 Mar;65(3):252-9. doi: 10.1111/j.1399-0039.2005.00359.x.
6 Association of KIR2DL5B gene with celiac disease supports the susceptibility locus on 19q13.4.Genes Immun. 2007 Mar;8(2):171-6. doi: 10.1038/sj.gene.6364367. Epub 2007 Jan 11.
7 Killer immunoglobulin-like receptor gene repertoire influences viral load of primary human cytomegalovirus infection in renal transplant patients.Genes Immun. 2014 Dec;15(8):562-8. doi: 10.1038/gene.2014.53. Epub 2014 Sep 25.
8 Human liver-derived CXCR6(+) NK cells are predominantly educated through NKG2A and show reduced cytokine production.J Leukoc Biol. 2019 Jun;105(6):1331-1340. doi: 10.1002/JLB.1MA1118-428R. Epub 2019 Feb 19.
9 Killer immunoglobulin-like receptor repertoire analysis in a Caucasian Spanish cohort with inflammatory bowel disease.Microbiol Immunol. 2016 Nov;60(11):787-792. doi: 10.1111/1348-0421.12447.
10 Natural killer cell killer immunoglobulin-like gene receptor polymorphisms in non-Hodgkin lymphoma: possible association with clinical course.Leuk Lymphoma. 2015;56(10):2902-7. doi: 10.3109/10428194.2015.1014361. Epub 2015 Mar 27.
11 Association between killer cell immunoglobulin-like receptor (KIR) polymorphisms and systemic lupus erythematosus (SLE) in populations: A PRISMA-compliant meta-analysis.Medicine (Baltimore). 2017 Mar;96(10):e6166. doi: 10.1097/MD.0000000000006166.
12 The investigation of killer cell immunoglobulin-like receptor genotyping in patients with systemic lupus erytematosus and systemic sclerosis.Clin Rheumatol. 2016 Apr;35(4):919-25. doi: 10.1007/s10067-016-3222-0. Epub 2016 Mar 9.
13 KIR2DS4, KIR2DL2, and KIR2DS4del are linked with basaloid tumors, lymph node metastasis, advanced stage and metastatic risk in head and neck squamous cell carcinoma.Exp Mol Pathol. 2020 Feb;112:104345. doi: 10.1016/j.yexmp.2019.104345. Epub 2019 Nov 18.
14 KIR2DL5 mutation and loss underlies sporadic dermal neurofibroma pathogenesis and growth.Oncotarget. 2017 Jul 18;8(29):47574-47585. doi: 10.18632/oncotarget.17736.
15 KIR/HLA gene combinations influence susceptibility to B-cell chronic lymphocytic leukemia and the clinical course of disease.Tissue Antigens. 2011 Aug;78(2):129-38. doi: 10.1111/j.1399-0039.2011.01721.x.
16 Association of Killer Cell Immunoglobulin- Like Receptor Genes in Iranian Patients with Rheumatoid Arthritis.PLoS One. 2015 Dec 11;10(12):e0143757. doi: 10.1371/journal.pone.0143757. eCollection 2015.
17 Predominance of the group A killer Ig-like receptor haplotypes in Korean patients with T1D.Ann N Y Acad Sci. 2006 Oct;1079:240-50. doi: 10.1196/annals.1375.037.
18 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.