Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSVEUQE)

• DOT Name: NADP-dependent malic enzyme (ME1)
• Synonyms: NADP-ME; EC 1.1.1.40; Malic enzyme 1
• Gene Name: ME1
• UniProt ID: MAOX_HUMAN
• PDB ID: 2AW5; 3WJA; 7X11; 7X12
• EC Number: 1.1.1.40
• Pfam ID: PF00390 ; PF03949
• Sequence:
  MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVK
  NFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKP
  RGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC
  GGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNC
  LIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQ
  GAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEE
  MKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
  YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLT
  TAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFV
  RSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
• Function: Catalyzes the oxidative decarboxylation of (S)-malate in the presence of NADP(+) and divalent metal ions, and decarboxylation of oxaloacetate.
• Tissue Specificity: Expressed in all tissues tested including liver, placenta and white adipose tissue.
• KEGG Pathway:
  Pyruvate metabolism (hsa00620)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  PPAR sig.ling pathway (hsa03320)
• Reactome Pathway:
  Pyruvate metabolism (R-HSA-70268)
  NFE2L2 regulating TCA cycle genes (R-HSA-9818025)
  PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of NADP-dependent malic enzyme (ME1).	[1]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of NADP-dependent malic enzyme (ME1).	[27]

46 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of NADP-dependent malic enzyme (ME1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of NADP-dependent malic enzyme (ME1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of NADP-dependent malic enzyme (ME1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of NADP-dependent malic enzyme (ME1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of NADP-dependent malic enzyme (ME1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of NADP-dependent malic enzyme (ME1).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of NADP-dependent malic enzyme (ME1).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of NADP-dependent malic enzyme (ME1).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of NADP-dependent malic enzyme (ME1).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of NADP-dependent malic enzyme (ME1).	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of NADP-dependent malic enzyme (ME1).	[11]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of NADP-dependent malic enzyme (ME1).	[12]
Selenium	DM25CGV	Approved	Selenium decreases the expression of NADP-dependent malic enzyme (ME1).	[13]
Menadione	DMSJDTY	Approved	Menadione increases the expression of NADP-dependent malic enzyme (ME1).	[10]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of NADP-dependent malic enzyme (ME1).	[14]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of NADP-dependent malic enzyme (ME1).	[15]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of NADP-dependent malic enzyme (ME1).	[16]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of NADP-dependent malic enzyme (ME1).	[17]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of NADP-dependent malic enzyme (ME1).	[18]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of NADP-dependent malic enzyme (ME1).	[2]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of NADP-dependent malic enzyme (ME1).	[2]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol affects the expression of NADP-dependent malic enzyme (ME1).	[19]
Clavulanate	DM2FGRT	Approved	Clavulanate increases the expression of NADP-dependent malic enzyme (ME1).	[20]
Benzoic acid	DMKB9FI	Approved	Benzoic acid increases the expression of NADP-dependent malic enzyme (ME1).	[17]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of NADP-dependent malic enzyme (ME1).	[21]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the expression of NADP-dependent malic enzyme (ME1).	[22]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of NADP-dependent malic enzyme (ME1).	[23]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of NADP-dependent malic enzyme (ME1).	[24]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of NADP-dependent malic enzyme (ME1).	[17]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of NADP-dependent malic enzyme (ME1).	[25]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of NADP-dependent malic enzyme (ME1).	[17]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of NADP-dependent malic enzyme (ME1).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of NADP-dependent malic enzyme (ME1).	[28]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of NADP-dependent malic enzyme (ME1).	[17]
Celastrol	DMWQIJX	Preclinical	Celastrol increases the expression of NADP-dependent malic enzyme (ME1).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of NADP-dependent malic enzyme (ME1).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of NADP-dependent malic enzyme (ME1).	[31]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of NADP-dependent malic enzyme (ME1).	[32]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of NADP-dependent malic enzyme (ME1).	[33]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of NADP-dependent malic enzyme (ME1).	[34]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of NADP-dependent malic enzyme (ME1).	[35]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of NADP-dependent malic enzyme (ME1).	[4]
Lead acetate	DML0GZ2	Investigative	Lead acetate increases the expression of NADP-dependent malic enzyme (ME1).	[36]
Daidzein	DMRFTJX	Investigative	Daidzein increases the expression of NADP-dependent malic enzyme (ME1).	[24]
methyl salicylate	DMKCG8H	Investigative	methyl salicylate increases the expression of NADP-dependent malic enzyme (ME1).	[17]
2-Propanol, Isopropanol	DML5O0H	Investigative	2-Propanol, Isopropanol increases the expression of NADP-dependent malic enzyme (ME1).	[17]

References

• [1] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [2] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Comparison of base-line and chemical-induced transcriptomic responses in HepaRG and RPTEC/TERT1 cells using TempO-Seq. Arch Toxicol. 2018 Aug;92(8):2517-2531.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [10] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [11] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [12] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [13] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [14] Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
• [15] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [16] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [17] Keratinocyte gene expression profiles discriminate sensitizing and irritating compounds. Toxicol Sci. 2010 Sep;117(1):81-9.
• [18] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [19] Targeting iron homeostasis induces cellular differentiation and synergizes with differentiating agents in acute myeloid leukemia. J Exp Med. 2010 Apr 12;207(4):731-50. doi: 10.1084/jem.20091488. Epub 2010 Apr 5.
• [20] Molecular mechanisms of hepatotoxic cholestasis by clavulanic acid: Role of NRF2 and FXR pathways. Food Chem Toxicol. 2021 Dec;158:112664. doi: 10.1016/j.fct.2021.112664. Epub 2021 Nov 9.
• [21] Differentially expressed genes in the prostate cancer cell line LNCaP after exposure to androgen and anti-androgen. Cancer Genet Cytogenet. 2006 Apr 15;166(2):130-8. doi: 10.1016/j.cancergencyto.2005.09.012.
• [22] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [23] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [24] Molecular signatures of soy-derived phytochemicals in androgen-responsive prostate cancer cells: a comparison study using DNA microarray. Mol Carcinog. 2006 Dec;45(12):943-56.
• [25] Regulation of aryl hydrocarbon receptor function by selective estrogen receptor modulators. Mol Endocrinol. 2010 Jan;24(1):33-46.
• [26] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [27] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [29] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
• [30] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [31] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [32] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [33] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [34] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [35] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [36] Analysis of lead toxicity in human cells. BMC Genomics. 2012 Jul 27;13:344.