Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW2H3ND)

DOT Name C-C motif chemokine 3 (CCL3)
Synonyms G0/G1 switch regulatory protein 19-1; Macrophage inflammatory protein 1-alpha; MIP-1-alpha; PAT 464.1; SIS-beta; Small-inducible cytokine A3; Tonsillar lymphocyte LD78 alpha protein
Gene Name CCL3
UniProt ID
CCL3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1B50; 1B53; 2X69; 2X6G; 3FPU; 3H44; 3KBX; 4RA8; 4ZKB; 5COR; 5D65; 7F1Q; 7F1T
Pfam ID
PF00048
Sequence
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Function
Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Viral protein interaction with cytokine and cytokine receptor (hsa04061 )
Chemokine sig.ling pathway (hsa04062 )
Toll-like receptor sig.ling pathway (hsa04620 )
Chagas disease (hsa05142 )
Human cytomegalovirus infection (hsa05163 )
Rheumatoid arthritis (hsa05323 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Interleukin-10 signaling (R-HSA-6783783 )
Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
50 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of C-C motif chemokine 3 (CCL3). [1]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of C-C motif chemokine 3 (CCL3). [2]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of C-C motif chemokine 3 (CCL3). [3]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of C-C motif chemokine 3 (CCL3). [4]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of C-C motif chemokine 3 (CCL3). [5]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of C-C motif chemokine 3 (CCL3). [6]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of C-C motif chemokine 3 (CCL3). [7]
Etoposide DMNH3PG Approved Etoposide increases the expression of C-C motif chemokine 3 (CCL3). [8]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of C-C motif chemokine 3 (CCL3). [9]
Malathion DMXZ84M Approved Malathion increases the expression of C-C motif chemokine 3 (CCL3). [10]
Gemcitabine DMSE3I7 Approved Gemcitabine increases the expression of C-C motif chemokine 3 (CCL3). [12]
Mifepristone DMGZQEF Approved Mifepristone decreases the expression of C-C motif chemokine 3 (CCL3). [13]
Pioglitazone DMKJ485 Approved Pioglitazone decreases the expression of C-C motif chemokine 3 (CCL3). [14]
Prednisolone DMQ8FR2 Approved Prednisolone increases the expression of C-C motif chemokine 3 (CCL3). [15]
Hydrocortisone DMGEMB7 Approved Hydrocortisone increases the expression of C-C motif chemokine 3 (CCL3). [15]
Diphenylpyraline DMW4X37 Approved Diphenylpyraline decreases the expression of C-C motif chemokine 3 (CCL3). [16]
Ritonavir DMU764S Approved Ritonavir increases the expression of C-C motif chemokine 3 (CCL3). [17]
Dinoprostone DMTYOPD Approved Dinoprostone decreases the expression of C-C motif chemokine 3 (CCL3). [18]
Isoproterenol DMK7MEY Approved Isoproterenol increases the expression of C-C motif chemokine 3 (CCL3). [19]
Dihydroxyacetone DMM1LG2 Approved Dihydroxyacetone decreases the expression of C-C motif chemokine 3 (CCL3). [20]
Atazanavir DMSYRBX Approved Atazanavir increases the expression of C-C motif chemokine 3 (CCL3). [17]
Penicillamine DM40EF6 Approved Penicillamine increases the expression of C-C motif chemokine 3 (CCL3). [21]
Nelfinavir mesylate DMFX6G8 Approved Nelfinavir mesylate increases the expression of C-C motif chemokine 3 (CCL3). [17]
Budesonide DMJIBAW Approved Budesonide increases the expression of C-C motif chemokine 3 (CCL3). [15]
Indinavir DM0T3YH Approved Indinavir increases the expression of C-C motif chemokine 3 (CCL3). [17]
Emetine DMCT2YF Approved Emetine decreases the expression of C-C motif chemokine 3 (CCL3). [15]
Fludrocortisone DMUDIR8 Approved Fludrocortisone increases the expression of C-C motif chemokine 3 (CCL3). [15]
Lopinavir DMITQS0 Approved Lopinavir increases the expression of C-C motif chemokine 3 (CCL3). [17]
Betamethasone DMAHJEF Approved Betamethasone increases the expression of C-C motif chemokine 3 (CCL3). [15]
Oxytetracycline DMOVH1M Approved Oxytetracycline decreases the expression of C-C motif chemokine 3 (CCL3). [15]
Amprenavir DMLMXE0 Approved Amprenavir increases the expression of C-C motif chemokine 3 (CCL3). [17]
Meclocycline DMSFQ8I Approved Meclocycline decreases the expression of C-C motif chemokine 3 (CCL3). [15]
Beclomethasone dipropionate DM5NW1E Phase 4 Beclomethasone dipropionate increases the expression of C-C motif chemokine 3 (CCL3). [15]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of C-C motif chemokine 3 (CCL3). [22]
Abexinostat DM91LGU Phase 3 Abexinostat decreases the expression of C-C motif chemokine 3 (CCL3). [23]
DNCB DMDTVYC Phase 2 DNCB increases the expression of C-C motif chemokine 3 (CCL3). [24]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of C-C motif chemokine 3 (CCL3). [25]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the expression of C-C motif chemokine 3 (CCL3). [26]
Eugenol DM7US1H Patented Eugenol increases the expression of C-C motif chemokine 3 (CCL3). [24]
Celastrol DMWQIJX Preclinical Celastrol increases the expression of C-C motif chemokine 3 (CCL3). [27]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of C-C motif chemokine 3 (CCL3). [29]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid increases the expression of C-C motif chemokine 3 (CCL3). [30]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of C-C motif chemokine 3 (CCL3). [31]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of C-C motif chemokine 3 (CCL3). [32]
Benzoquinone DMNBA0G Investigative Benzoquinone increases the expression of C-C motif chemokine 3 (CCL3). [6]
27-hydroxycholesterol DM2L6OZ Investigative 27-hydroxycholesterol increases the expression of C-C motif chemokine 3 (CCL3). [34]
Catechol DML0YEK Investigative Catechol increases the expression of C-C motif chemokine 3 (CCL3). [6]
PALMATINE DMJCOKV Investigative PALMATINE decreases the expression of C-C motif chemokine 3 (CCL3). [15]
7alpha-hydroxycholesterol DMH6LD0 Investigative 7alpha-hydroxycholesterol increases the expression of C-C motif chemokine 3 (CCL3). [34]
Propidium DMZ1FRS Investigative Propidium decreases the expression of C-C motif chemokine 3 (CCL3). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Drug(s)
4 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cocaine DMSOX7I Approved Cocaine increases the secretion of C-C motif chemokine 3 (CCL3). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the secretion of C-C motif chemokine 3 (CCL3). [28]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the secretion of C-C motif chemokine 3 (CCL3). [33]
Heme DMGC287 Investigative Heme increases the secretion of C-C motif chemokine 3 (CCL3). [35]
------------------------------------------------------------------------------------

References

1 Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
2 Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
3 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
4 A novel bioluminescent mouse model and effective therapy for adult T-cell leukemia/lymphoma. Cancer Res. 2007 Dec 15;67(24):11859-66. doi: 10.1158/0008-5472.CAN-07-1701.
5 Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
6 Identification of human cell responses to benzene and benzene metabolites. Genomics. 2007 Sep;90(3):324-33.
7 Effects of chronic rosiglitazone therapy on gene expression in human adipose tissue in vivo in patients with type 2 diabetes. J Clin Endocrinol Metab. 2007 Feb;92(2):720-4.
8 Expression and release of chemokines associated with apoptotic cell death in human promonocytic U937 cells and peripheral blood mononuclear cells. Eur J Immunol. 1999 Oct;29(10):3225-35. doi: 10.1002/(SICI)1521-4141(199910)29:10<3225::AID-IMMU3225>3.0.CO;2-0.
9 Dasatinib, a small-molecule protein tyrosine kinase inhibitor, inhibits T-cell activation and proliferation. Blood. 2008 Feb 1;111(3):1366-77. doi: 10.1182/blood-2007-04-084814. Epub 2007 Oct 25.
10 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
11 Cocaine opens the blood-brain barrier to HIV-1 invasion. J Neurovirol. 1998 Dec;4(6):619-26. doi: 10.3109/13550289809114228.
12 Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
13 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
14 Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
15 Cell-based and cytokine-directed chemical screen to identify potential anti-multiple myeloma agents. Leuk Res. 2010 Jul;34(7):917-24. doi: 10.1016/j.leukres.2009.12.002. Epub 2010 Feb 8.
16 Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
17 Some HIV antiretrovirals increase oxidative stress and alter chemokine, cytokine or adiponectin production in human adipocytes and macrophages. Antivir Ther. 2007;12(4):489-500.
18 Maturation of human monocyte-derived dendritic cells (MoDCs) in the presence of prostaglandin E2 optimizes CD4 and CD8 T cell-mediated responses to protein antigens: role of PGE2 in chemokine and cytokine expression by MoDCs. Int Immunol. 2005 Dec;17(12):1561-72. doi: 10.1093/intimm/dxh335. Epub 2005 Nov 22.
19 Isoproterenol effects evaluated in heart slices of human and rat in comparison to rat heart in vivo. Toxicol Appl Pharmacol. 2014 Jan 15;274(2):302-12.
20 The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
21 D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
22 Grape resveratrol increases serum adiponectin and downregulates inflammatory genes in peripheral blood mononuclear cells: a triple-blind, placebo-controlled, one-year clinical trial in patients with stable coronary artery disease. Cardiovasc Drugs Ther. 2013 Feb;27(1):37-48. doi: 10.1007/s10557-012-6427-8.
23 PCI-24781 induces caspase and reactive oxygen species-dependent apoptosis through NF-kappaB mechanisms and is synergistic with bortezomib in lymphoma cells. Clin Cancer Res. 2009 May 15;15(10):3354-65. doi: 10.1158/1078-0432.CCR-08-2365. Epub 2009 May 5.
24 Cytokine transcript profiling in CD34+-progenitor derived dendritic cells exposed to contact allergens and irritants. Toxicol Lett. 2005 Jan 15;155(1):187-94. doi: 10.1016/j.toxlet.2004.09.014.
25 Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
26 Hepatic co-cultures in vitro reveal suitable to detect Nrf2-mediated oxidative stress responses on the bladder carcinogen o-anisidine. Toxicol In Vitro. 2017 Apr;40:153-160.
27 The quinone methide aurin is a heat shock response inducer that causes proteotoxic stress and Noxa-dependent apoptosis in malignant melanoma cells. J Biol Chem. 2015 Jan 16;290(3):1623-38.
28 Bisphenol-A impairs insulin action and up-regulates inflammatory pathways in human subcutaneous adipocytes and 3T3-L1 cells. PLoS One. 2013 Dec 9;8(12):e82099. doi: 10.1371/journal.pone.0082099. eCollection 2013.
29 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
30 Capsaicin attenuates palmitate-induced expression of macrophage inflammatory protein 1 and interleukin 8 by increasing palmitate oxidation and reducing c-Jun activation in THP-1 (human acute monocytic leukemia cell) cells. Nutr Res. 2011 Jun;31(6):468-78. doi: 10.1016/j.nutres.2011.05.007. Epub 2011 Jun 17.
31 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
32 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
33 Evaluation of selected biomarkers for the detection of chemical sensitization in human skin: a comparative study applying THP-1, MUTZ-3 and primary dendritic cells in culture. Toxicol In Vitro. 2013 Sep;27(6):1659-69. doi: 10.1016/j.tiv.2013.04.009. Epub 2013 Apr 26.
34 27-Hydroxycholesterol and 7alpha-hydroxycholesterol trigger a sequence of events leading to migration of CCR5-expressing Th1 lymphocytes. Toxicol Appl Pharmacol. 2014 Feb 1;274(3):462-70. doi: 10.1016/j.taap.2013.12.007. Epub 2013 Dec 24.
35 Role of 15-hydroxyeicosatetraenoic acid in hemozoin-induced lysozyme release from human adherent monocytes. Biofactors. 2013 May-Jun;39(3):304-14. doi: 10.1002/biof.1071. Epub 2013 Jan 28.