Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW4098I)

DOT Name 2-iminobutanoate/2-iminopropanoate deaminase (RIDA)
Synonyms
EC 3.5.99.10; 14.5 kDa translational inhibitor protein; hp14.5; p14.5; Heat-responsive protein 12; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog
Gene Name RIDA
Related Disease
Attention deficit hyperactivity disorder ( )
Neoplasm ( )
Schizophrenia ( )
Wolfram syndrome ( )
Advanced cancer ( )
Autonomic nervous system disorder ( )
Bipolar disorder ( )
Corticobasal degeneration ( )
Dementia ( )
Depression ( )
Dysautonomia ( )
Familial spontaneous pneumothorax ( )
Frontotemporal dementia ( )
Gastroenteritis ( )
Influenza ( )
Late-onset Parkinson disease ( )
Matthew-Wood syndrome ( )
Myotonic dystrophy ( )
Parkinson disease ( )
Pick disease ( )
Pneumothorax ( )
Postencephalitic Parkinson disease ( )
Primary progressive aphasia ( )
Progressive supranuclear palsy ( )
Prostate adenocarcinoma ( )
Sjogren syndrome ( )
Tauopathy ( )
Type-1/2 diabetes ( )
Anxiety ( )
Anxiety disorder ( )
Lewy body dementia ( )
Nervous system disease ( )
Nutritional disorder ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
RIDA_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1ONI
EC Number
3.5.99.10
Pfam ID
PF01042
Sequence
MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALK
NMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSR
IEIEAVAIQGPLTTASL
Function
Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular components. It may act on enamine/imine intermediates formed by several types of pyridoxal-5'-phosphate-dependent dehydratases including L-threonine dehydratase; Also promotes endoribonucleolytic cleavage of some transcripts by promoting recruitment of the ribonuclease P/MRP complex. Acts by bridging YTHDF2 and the ribonuclease P/MRP complex. RIDA/HRSP12 binds to N6-methyladenosine (m6A)-containing mRNAs containing a 5'-GGUUC-3' motif: cooperative binding of RIDA/HRSP12 and YTHDF2 to such transcripts lead to recruitment of the ribonuclease P/MRP complex and subsequent endoribonucleolytic cleavage.
Tissue Specificity Expressed predominantly in liver and kidney. Lower levels in lung and brain.
Reactome Pathway
Threonine catabolism (R-HSA-8849175 )

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Attention deficit hyperactivity disorder DISL8MX9 Definitive Biomarker [1]
Neoplasm DISZKGEW Definitive Altered Expression [2]
Schizophrenia DISSRV2N Definitive Altered Expression [1]
Wolfram syndrome DISN16XW Definitive Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Autonomic nervous system disorder DIS6JLTA Strong Biomarker [5]
Bipolar disorder DISAM7J2 Strong Biomarker [6]
Corticobasal degeneration DISSMOTT Strong Biomarker [7]
Dementia DISXL1WY Strong Biomarker [8]
Depression DIS3XJ69 Strong Biomarker [6]
Dysautonomia DISF4MT6 Strong Biomarker [5]
Familial spontaneous pneumothorax DISNM7SU Strong Biomarker [9]
Frontotemporal dementia DISKYHXL Strong Biomarker [10]
Gastroenteritis DISXQCG5 Strong Biomarker [11]
Influenza DIS3PNU3 Strong Genetic Variation [12]
Late-onset Parkinson disease DIS9IOUI Strong Biomarker [13]
Matthew-Wood syndrome DISA7HR7 Strong Genetic Variation [2]
Myotonic dystrophy DISNBEMX Strong Biomarker [5]
Parkinson disease DISQVHKL Strong Genetic Variation [14]
Pick disease DISP6X50 Strong Genetic Variation [15]
Pneumothorax DISP86H1 Strong Genetic Variation [16]
Postencephalitic Parkinson disease DIS1TYXP Strong Biomarker [8]
Primary progressive aphasia DISLRYFE Strong Biomarker [17]
Progressive supranuclear palsy DISO5KRQ Strong Biomarker [18]
Prostate adenocarcinoma DISBZYU8 Strong Genetic Variation [19]
Sjogren syndrome DISUBX7H Strong Biomarker [20]
Tauopathy DISY2IPA Strong Genetic Variation [15]
Type-1/2 diabetes DISIUHAP Strong Altered Expression [3]
Anxiety DISIJDBA Disputed Biomarker [21]
Anxiety disorder DISBI2BT Disputed Biomarker [21]
Lewy body dementia DISAE66J Limited Biomarker [22]
Nervous system disease DISJ7GGT Limited Biomarker [18]
Nutritional disorder DIS0W6QK Limited Biomarker [23]
Prostate cancer DISF190Y Limited Biomarker [24]
Prostate carcinoma DISMJPLE Limited Biomarker [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 35 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [25]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [26]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [27]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [28]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [29]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [30]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [31]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [32]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [33]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of 2-iminobutanoate/2-iminopropanoate deaminase (RIDA). [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Cognitive and behavioral precursors of schizophrenia.Dev Psychopathol. 1999 Summer;11(3):487-508. doi: 10.1017/s0954579499002175.
2 Human pancreatic cancer contains a side population expressing cancer stem cell-associated and prognostic genes.PLoS One. 2013 Sep 17;8(9):e73968. doi: 10.1371/journal.pone.0073968. eCollection 2013.
3 Pancreatic stone protein/regenerating protein is a potential biomarker for endoplasmic reticulum stress in beta cells.Sci Rep. 2019 Mar 26;9(1):5199. doi: 10.1038/s41598-019-41604-4.
4 Analyzing the capability of PSP, PCT and sCD25 to support the diagnosis of infection in cancer patients with febrile neutropenia.Clin Chem Lab Med. 2019 Mar 26;57(4):540-548. doi: 10.1515/cclm-2018-0154.
5 Coexistence of Progressive Supranuclear Palsy With Pontocerebellar Atrophy and Myotonic Dystrophy Type 1.J Neuropathol Exp Neurol. 2019 Aug 1;78(8):756-762. doi: 10.1093/jnen/nlz048.
6 Self-Reported Graphic Personal and Social Performance Scale (SRG-PSP) for measuring functionality in patients with bipolar disorder.J Affect Disord. 2017 Jun;215:256-262. doi: 10.1016/j.jad.2017.02.018. Epub 2017 Feb 20.
7 Side effects induced by the acute levodopa challenge in Parkinson's Disease and atypical parkinsonisms.PLoS One. 2017 Feb 16;12(2):e0172145. doi: 10.1371/journal.pone.0172145. eCollection 2017.
8 Parkinson's syndrome associated with neurofibrillary degeneration and tau pathologic findings.Mov Disord. 2003 Sep;18 Suppl 6:S28-33. doi: 10.1002/mds.10560.
9 A novel dual-covering method in video-assisted thoracic surgery for pediatric primary spontaneous pneumothorax.Surg Today. 2019 Jul;49(7):587-592. doi: 10.1007/s00595-019-01785-x. Epub 2019 Apr 6.
10 Cerebellar atrophy in neurodegeneration-a meta-analysis.J Neurol Neurosurg Psychiatry. 2017 Sep;88(9):780-788. doi: 10.1136/jnnp-2017-315607. Epub 2017 May 13.
11 Multicenter evaluation of the revised RIDA QUICK test (N1402) for rapid detection of norovirus in a diagnostic laboratory setting.Diagn Microbiol Infect Dis. 2017 May;88(1):31-35. doi: 10.1016/j.diagmicrobio.2017.02.006. Epub 2017 Feb 12.
12 Evaluation of a multiplex real-time polymerase chain reaction assay for the detection of influenza and respiratory syncytial viruses.Diagn Microbiol Infect Dis. 2016 Jan;84(1):40-42. doi: 10.1016/j.diagmicrobio.2015.09.014. Epub 2015 Sep 25.
13 Manual MRI morphometry in Parkinsonian syndromes.Mov Disord. 2017 May;32(5):778-782. doi: 10.1002/mds.26921. Epub 2017 Feb 2.
14 The genetic and clinico-pathological profile of early-onset progressive supranuclear palsy.Mov Disord. 2019 Sep;34(9):1307-1314. doi: 10.1002/mds.27786. Epub 2019 Jul 12.
15 Involvement of Oligodendrocytes in Tau Seeding and Spreading in Tauopathies.Front Aging Neurosci. 2019 May 28;11:112. doi: 10.3389/fnagi.2019.00112. eCollection 2019.
16 Primary and Secondary Spontaneous Pneumothorax: Prevalence, Clinical Features, and In-Hospital Mortality.Can Respir J. 2017;2017:6014967. doi: 10.1155/2017/6014967. Epub 2017 Mar 13.
17 C9ORF72 repeat expansions in the frontotemporal dementias spectrum of diseases: a flow-chart for genetic testing.J Alzheimers Dis. 2013;34(2):485-99. doi: 10.3233/JAD-121456.
18 Sensitivity and Specificity of Diagnostic Criteria for Progressive Supranuclear Palsy.Mov Disord. 2019 Aug;34(8):1144-1153. doi: 10.1002/mds.27619. Epub 2019 Feb 6.
19 A novel knock-in prostate cancer model demonstrates biology similar to that of human prostate cancer and suitable for preclinical studies.Mol Ther. 2005 Mar;11(3):348-62. doi: 10.1016/j.ymthe.2004.12.005.
20 Novel Sjgren's autoantibodies found in fibromyalgia patients with sicca and/or xerostomia.Autoimmun Rev. 2019 Feb;18(2):199-202. doi: 10.1016/j.autrev.2018.09.004. Epub 2018 Dec 18.
21 Psychological factors predict an unfavorable pain trajectory after hysterectomy: a prospective cohort study on chronic postsurgical pain.Pain. 2018 May;159(5):956-967. doi: 10.1097/j.pain.0000000000001170.
22 Non-Alzheimer's disease dementias: anatomic, clinical, and molecular correlates.Can J Psychiatry. 2004 Mar;49(3):164-71. doi: 10.1177/070674370404900303.
23 Radiolucent and calcified pancreatic lithiasis: two different diseases. Role of alcohol and heredity.Scand J Gastroenterol. 1992;27(1):71-6. doi: 10.3109/00365529209011170.
24 Comparison of prostate-specific promoters and the use of PSP-driven virotherapy for prostate cancer.Biomed Res Int. 2013;2013:624632. doi: 10.1155/2013/624632. Epub 2013 Jan 31.
25 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
26 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
27 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
28 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
29 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
30 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
31 Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
32 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
33 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
34 Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.