Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW71IK4)

• DOT Name: Tissue alpha-L-fucosidase (FUCA1)
• Synonyms: EC 3.2.1.51; Alpha-L-fucosidase I; Alpha-L-fucoside fucohydrolase 1; Alpha-L-fucosidase 1
• Gene Name: FUCA1
• Related Disease:
  Fucosidosis
  Thyroid cancer
  Thyroid gland carcinoma
  Advanced cancer
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Diabetic retinopathy
  HIV infectious disease
  Intellectual disability
  Metastatic malignant neoplasm
  Neoplasm
  Sjogren syndrome
  Squamous cell carcinoma
  Lysosomal storage disease
  Thyroid gland papillary carcinoma
  Thyroid gland undifferentiated (anaplastic) carcinoma
  Thyroid tumor
• UniProt ID: FUCO_HUMAN
• PDB ID: 7PLS; 7PM4
• EC Number: 3.2.1.51
• Pfam ID: PF01120 ; PF16757
• Sequence:
  MRAPGMRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGV
  FIHWGVFSVPAWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEW
  ADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYG
  LYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYW
  NSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCEDKFKPQSLPDHKWEMCTSID
  KFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGK
  WLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTK
  ITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
• Function: Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
• KEGG Pathway:
  Other glycan degradation (hsa00511)
  Lysosome (hsa04142)
• Reactome Pathway:
  Reactions specific to the complex N-glycan synthesis pathway (R-HSA-975578)
  Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Fucosidosis	DISCNE67	Definitive	Autosomal recessive	[1]
Thyroid cancer	DIS3VLDH	Definitive	Altered Expression	[2]
Thyroid gland carcinoma	DISMNGZ0	Definitive	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Autoimmune disease	DISORMTM	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[6]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[6]
Diabetic retinopathy	DISHGUJM	Strong	Biomarker	[7]
HIV infectious disease	DISO97HC	Strong	Altered Expression	[8]
Intellectual disability	DISMBNXP	Strong	Biomarker	[9]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[5]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Sjogren syndrome	DISUBX7H	Strong	Biomarker	[10]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[3]
Lysosomal storage disease	DIS6QM6U	Limited	Genetic Variation	[11]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Altered Expression	[2]
Thyroid gland undifferentiated (anaplastic) carcinoma	DISYBB1W	Limited	Altered Expression	[2]
Thyroid tumor	DISLVKMD	Limited	Altered Expression	[2]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Tissue alpha-L-fucosidase (FUCA1) affects the response to substance of Topotecan.	[31]
Capecitabine	DMTS85L	Approved	Tissue alpha-L-fucosidase (FUCA1) increases the response to substance of Capecitabine.	[32]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[12]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Tissue alpha-L-fucosidase (FUCA1).	[13]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[14]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[15]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Tissue alpha-L-fucosidase (FUCA1).	[16]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Tissue alpha-L-fucosidase (FUCA1).	[17]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[18]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Tissue alpha-L-fucosidase (FUCA1).	[19]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[20]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[21]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Tissue alpha-L-fucosidase (FUCA1).	[22]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[23]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Tissue alpha-L-fucosidase (FUCA1).	[24]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[25]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Tissue alpha-L-fucosidase (FUCA1).	[27]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[25]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Tissue alpha-L-fucosidase (FUCA1).	[28]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[29]
PP-242	DM2348V	Investigative	PP-242 increases the expression of Tissue alpha-L-fucosidase (FUCA1).	[30]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Human a-L-fucosidase-1 attenuates the invasive properties of thyroid cancer.Oncotarget. 2017 Apr 18;8(16):27075-27092. doi: 10.18632/oncotarget.15635.
• [3] Alpha-L-fucosidase-1 is a diagnostic marker that distinguishes mucoepidermoid carcinoma from squamous cell carcinoma.Pathol Int. 2019 Feb;69(2):76-85. doi: 10.1111/pin.12764. Epub 2019 Feb 6.
• [4] Plasma alpha-L-fucosidase activity in chronic inflammation and autoimmune disorders in a pediatric cohort of hospitalized patients.Immunol Res. 2017 Oct;65(5):1025-1030. doi: 10.1007/s12026-017-8943-x.
• [5] Reduced expression of -L-Fucosidase-1 (FUCA-1) predicts recurrence and shorter cancer specific survival in luminal B LN+ breast cancer patients.Oncotarget. 2018 Feb 7;9(20):15228-15238. doi: 10.18632/oncotarget.24445. eCollection 2018 Mar 16.
• [6] Decreased expression of alpha-L-fucosidase gene FUCA1 in human colorectal tumors.Int J Mol Sci. 2013 Aug 19;14(8):16986-98. doi: 10.3390/ijms140816986.
• [7] In vitro and in vivo alterations of enzymatic glycosylation in diabetes.Life Sci. 1999;64(17):1571-83. doi: 10.1016/s0024-3205(99)00094-6.
• [8] Activity of lysosomal exoglycosidases in saliva of patients with HIV infection.Adv Med Sci. 2007;52:186-90.
• [9] A mutation generating a stop codon in the alpha-L-fucosidase gene of a fucosidosis patient.Biochem Biophys Res Commun. 1992 Dec 15;189(2):1063-8. doi: 10.1016/0006-291x(92)92312-l.
• [10] Plasma -L-fucosidase-1 in patients with Sjgren's syndrome and other rheumatic disorders.Int J Rheum Dis. 2019 Sep;22(9):1762-1767. doi: 10.1111/1756-185X.13639. Epub 2019 Aug 16.
• [11] Mutation identification and characterization of a Taiwanese patient with fucosidosis.J Hum Genet. 2007;52(6):553-556. doi: 10.1007/s10038-007-0136-3. Epub 2007 Apr 11.
• [12] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [13] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [14] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [15] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [16] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [17] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [18] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [19] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [20] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [21] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [22] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [23] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [24] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [25] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [26] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [27] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [28] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [29] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
• [30] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
• [31] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [32] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.