Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXQZHCR)

• DOT Name: Arf-GAP domain and FG repeat-containing protein 2 (AGFG2)
• Synonyms: HIV-1 Rev-binding protein-like protein; Rev/Rex activation domain-binding protein related; RAB-R
• Gene Name: AGFG2
• Related Disease:
  Female hypogonadism
  Acute leukaemia
  Alzheimer disease
  Atrial fibrillation
  Childhood myelodysplastic syndrome
  Chronic myelomonocytic leukemia
  Endometriosis
  Haematological malignancy
  leukaemia
  Melanoma
  Myelodysplastic syndrome
  Neoplasm
  Prostate cancer
  Prostate carcinoma
  Retinoblastoma
  Triple-A syndrome
  Advanced cancer
  Acute myelogenous leukaemia
  Leukemia
  Nervous system disease
• UniProt ID: AGFG2_HUMAN
• Pfam ID: PF01412
• Sequence:
  MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDI
  TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTS
  LVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPTYTKGSASTPVQGSIPEGKPLRTLLG
  DPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMA
  PAFAAFPAFGGQTPSQGGFANFDAFSSGPSSSVFGSLPPAGQASFQAQPTPAGSSQGTPF
  GATPLAPASQPNSLADVGSFLGPGVPAAGVPSSLFGMAGQVPPLQSVTMGGGGGSSTGLA
  FGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAP
  LFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTNPF
  L

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Female hypogonadism	DISWASB4	Definitive	Biomarker	[1]
Acute leukaemia	DISDQFDI	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[3]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[4]
Childhood myelodysplastic syndrome	DISMN80I	Strong	Genetic Variation	[5]
Chronic myelomonocytic leukemia	DISIL8UR	Strong	Genetic Variation	[6]
Endometriosis	DISX1AG8	Strong	Biomarker	[7]
Haematological malignancy	DISCDP7W	Strong	Biomarker	[8]
leukaemia	DISS7D1V	Strong	Genetic Variation	[9]
Melanoma	DIS1RRCY	Strong	Genetic Variation	[10]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[10]
Prostate cancer	DISF190Y	Strong	Biomarker	[12]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[12]
Retinoblastoma	DISVPNPB	Strong	Altered Expression	[13]
Triple-A syndrome	DISCOH2J	Strong	Biomarker	[14]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[15]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[16]
Leukemia	DISNAKFL	Limited	Genetic Variation	[17]
Nervous system disease	DISJ7GGT	Limited	Biomarker	[18]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[19]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[20]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[21]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[22]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[23]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[24]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[19]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[27]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[28]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[29]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Arf-GAP domain and FG repeat-containing protein 2 (AGFG2).	[26]

References

• [1] A mutation in the nucleoporin-107 gene causes XX gonadal dysgenesis. J Clin Invest. 2015 Nov 2;125(11):4295-304. doi: 10.1172/JCI83553. Epub 2015 Oct 20.
• [2] Critical role of retinoid/rexinoid signaling in mediating transformation and therapeutic response of NUP98-RARG leukemia.Leukemia. 2015 May;29(5):1153-62. doi: 10.1038/leu.2014.334. Epub 2014 Dec 16.
• [3] GWAS on family history of Alzheimer's disease.Transl Psychiatry. 2018 May 18;8(1):99. doi: 10.1038/s41398-018-0150-6.
• [4] Lamin A mutation impairs interaction with nucleoporin NUP155 and disrupts nucleocytoplasmic transport in atrial fibrillation.Hum Mutat. 2019 Mar;40(3):310-325. doi: 10.1002/humu.23691. Epub 2018 Dec 8.
• [5] Enforced expression of NUP98-HOXA9 in human CD34(+) cells enhances stem cell proliferation.Cancer Res. 2006 Dec 15;66(24):11781-91. doi: 10.1158/0008-5472.CAN-06-0706.
• [6] NUP98-HBO1-fusion generates phenotypically and genetically relevant chronic myelomonocytic leukemia pathogenesis.Blood Adv. 2019 Apr 9;3(7):1047-1060. doi: 10.1182/bloodadvances.2018025007.
• [7] Functional polymorphism within NUP210 encoding for nucleoporin GP210 is associated with the risk of endometriosis.Fertil Steril. 2019 Aug;112(2):343-352.e1. doi: 10.1016/j.fertnstert.2019.04.011. Epub 2019 Jun 27.
• [8] NUP98 Fusion Proteins Interact with the NSL and MLL1 Complexes to Drive Leukemogenesis.Cancer Cell. 2016 Dec 12;30(6):863-878. doi: 10.1016/j.ccell.2016.10.019. Epub 2016 Nov 23.
• [9] Candidate genes for expansion and transformation of hematopoietic stem cells by NUP98-HOX fusion genes.PLoS One. 2007 Aug 22;2(8):e768. doi: 10.1371/journal.pone.0000768.
• [10] Analysis of Mucosal Melanoma Whole-Genome Landscapes Reveals Clinically Relevant Genomic Aberrations.Clin Cancer Res. 2019 Jun 15;25(12):3548-3560. doi: 10.1158/1078-0432.CCR-18-3442. Epub 2019 Feb 19.
• [11] Loss of p53 accelerates the complications of myelodysplastic syndrome in a NUP98-HOXD13-driven mouse model.Blood. 2012 Oct 11;120(15):3089-97. doi: 10.1182/blood-2012-01-405332. Epub 2012 Aug 27.
• [12] Targeting Nucleoporin POM121-Importin Axis in Prostate Cancer.Cell Chem Biol. 2018 Sep 20;25(9):1056-1058. doi: 10.1016/j.chembiol.2018.09.003.
• [13] Distinct Gene Expression Profiles Define Anaplastic Grade in Retinoblastoma.Am J Pathol. 2018 Oct;188(10):2328-2338. doi: 10.1016/j.ajpath.2018.06.013. Epub 2018 Jul 21.
• [14] Loss of the nucleoporin Aladin in central nervous system and fibroblasts of Allgrove Syndrome.Hum Mol Genet. 2019 Dec 1;28(23):3921-3927. doi: 10.1093/hmg/ddz236.
• [15] Importin- and CRM1 control a RANBP2 spatiotemporal switch essential for mitotic kinetochore function.J Cell Sci. 2017 Aug 1;130(15):2564-2578. doi: 10.1242/jcs.197905. Epub 2017 Jun 9.
• [16] Transforming activities of the NUP98-KMT2A fusion gene associated with myelodysplasia and acute myeloid leukemia.Haematologica. 2020 Jul;105(7):1857-1867. doi: 10.3324/haematol.2019.219188. Epub 2019 Sep 26.
• [17] Nuclear pore proteins and cancer.Semin Cell Dev Biol. 2009 Jul;20(5):620-30. doi: 10.1016/j.semcdb.2009.03.003. Epub 2009 Mar 18.
• [18] Loss of Ranbp2 in motoneurons causes disruption of nucleocytoplasmic and chemokine signaling, proteostasis of hnRNPH3 and Mmp28, and development of amyotrophic lateral sclerosis-like syndromes.Dis Model Mech. 2017 May 1;10(5):559-579. doi: 10.1242/dmm.027730. Epub 2017 Jan 18.
• [19] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [20] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [21] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [22] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [23] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [24] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [25] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [26] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [27] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [28] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [29] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [30] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.