Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYGAQS0)

• DOT Name: Transmembrane emp24 domain-containing protein 9 (TMED9)
• Synonyms: GMP25; Glycoprotein 25L2; p24 family protein alpha-2; p24alpha2; p25
• Gene Name: TMED9
• Related Disease:
  Adult T-cell leukemia/lymphoma
  Amyotrophic lateral sclerosis
  Autosomal dominant optic atrophy, classic form
  Clear cell renal carcinoma
  Generalized anxiety disorder
  Huntington disease
  Insomnia
  Latent tuberculosis infection
  Malaria
  Motor neurone disease
  Neoplasm
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Status epilepticus seizure
  T-cell leukaemia
  Tuberculosis
  Unverricht-Lundborg syndrome
  Frontotemporal dementia
  Stroke
  Colon cancer
  Colon carcinoma
  Metastatic malignant neoplasm
  Nervous system disease
• UniProt ID: TMED9_HUMAN
• Pfam ID: PF01105
• Sequence:
  MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMV
  IGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQI
  CLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQK
  EQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV
• Function: Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to membranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi membranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular membranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 isoform PTPB.
• Reactome Pathway:
  COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434)
  COPI-mediated anterograde transport (R-HSA-6807878)

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[1]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[2]
Autosomal dominant optic atrophy, classic form	DISXUAV9	Strong	Altered Expression	[3]
Clear cell renal carcinoma	DISBXRFJ	Strong	Genetic Variation	[4]
Generalized anxiety disorder	DISPSQCW	Strong	Biomarker	[5]
Huntington disease	DISQPLA4	Strong	Altered Expression	[6]
Insomnia	DIS0AFR7	Strong	Biomarker	[5]
Latent tuberculosis infection	DIS6R1EH	Strong	Biomarker	[7]
Malaria	DISQ9Y50	Strong	Biomarker	[8]
Motor neurone disease	DISUHWUI	Strong	Biomarker	[9]
Neoplasm	DISZKGEW	Strong	Biomarker	[10]
Parkinson disease	DISQVHKL	Strong	Biomarker	[11]
Prostate cancer	DISF190Y	Strong	Biomarker	[12]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[12]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[4]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[13]
T-cell leukaemia	DISJ6YIF	Strong	Biomarker	[1]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[7]
Unverricht-Lundborg syndrome	DISG4WLX	Strong	Biomarker	[14]
Frontotemporal dementia	DISKYHXL	moderate	Genetic Variation	[15]
Stroke	DISX6UHX	moderate	Biomarker	[16]
Colon cancer	DISVC52G	Limited	Biomarker	[17]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[17]
Nervous system disease	DISJ7GGT	Limited	Altered Expression	[18]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[22]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[23]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[24]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[24]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[25]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[26]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[29]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Transmembrane emp24 domain-containing protein 9 (TMED9).	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transmembrane emp24 domain-containing protein 9 (TMED9).	[27]

References

• [1] A B-cell line having chromosome 14 aberration at break band q11 derived from an adult T-cell leukemia patient.Jpn J Cancer Res. 1988 Jan;79(1):12-6. doi: 10.1111/j.1349-7006.1988.tb00004.x.
• [2] Sensory cortex hyperexcitability predicts short survival in amyotrophic lateral sclerosis.Neurology. 2018 May 1;90(18):e1578-e1587. doi: 10.1212/WNL.0000000000005424. Epub 2018 Mar 30.
• [3] Cyclin-dependent kinase 5 activator p25 is generated during memory formation and is reduced at an early stage in Alzheimer's disease.Biol Psychiatry. 2011 Jul 15;70(2):159-68. doi: 10.1016/j.biopsych.2011.04.011. Epub 2011 May 26.
• [4] Major role for a 3p21 region and lack of involvement of the t(3;8) breakpoint region in the development of renal cell carcinoma suggested by loss of heterozygosity analysis.Genes Chromosomes Cancer. 1996 Jan;15(1):64-72. doi: 10.1002/(SICI)1098-2264(199601)15:1<64::AID-GCC9>3.0.CO;2-2.
• [5] The Effect of Insomnia on Cortical Excitability in Patients With Generalized Anxiety Disorder.Front Psychiatry. 2019 Jan 10;9:755. doi: 10.3389/fpsyt.2018.00755. eCollection 2018.
• [6] p35 hemizygosity activates Akt but does not improve motor function in the YAC128 mouse model of Huntington's disease.Neuroscience. 2017 Jun 3;352:79-87. doi: 10.1016/j.neuroscience.2017.03.051. Epub 2017 Apr 6.
• [7] Sequential pulmonary immunization with heterologous recombinant influenza A virus tuberculosis vaccines protects against murine M. tuberculosis infection.Vaccine. 2018 Apr 25;36(18):2462-2470. doi: 10.1016/j.vaccine.2018.03.037. Epub 2018 Mar 27.
• [8] Immunization with Transgenic Rodent Malaria Parasites Expressing Pfs25 Induces Potent Transmission-Blocking Activity.Sci Rep. 2018 Jan 25;8(1):1573. doi: 10.1038/s41598-017-18831-8.
• [9] Mutant superoxide dismutase 1 causes motor neuron degeneration independent of cyclin-dependent kinase 5 activation by p35 or p25.J Neurochem. 2004 Mar;88(5):1295-304. doi: 10.1046/j.1471-4159.2003.02256.x.
• [10] Whole lesion histogram analysis of meningiomas derived from ADC values. Correlation with several cellularity parameters, proliferation index KI 67, nucleic content, and membrane permeability.Magn Reson Imaging. 2018 Sep;51:158-162. doi: 10.1016/j.mri.2018.05.009. Epub 2018 May 18.
• [11] Cdk5 Inhibitory Peptide Prevents Loss of Dopaminergic Neurons and Alleviates Behavioral Changes in an MPTP Induced Parkinson's Disease Mouse Model.Front Aging Neurosci. 2018 Jun 1;10:162. doi: 10.3389/fnagi.2018.00162. eCollection 2018.
• [12] Involvement of Cdk5/p25 in digoxin-triggered prostate cancer cell apoptosis.J Biol Chem. 2004 Jul 9;279(28):29302-7. doi: 10.1074/jbc.M403664200. Epub 2004 Apr 30.
• [13] Interaction of GABA(A) and GABA(B) antagonists after status epilepticus in immature rats.Epilepsy Behav. 2020 Jan;102:106683. doi: 10.1016/j.yebeh.2019.106683. Epub 2019 Nov 21.
• [14] Long-term follow-up of cortical hyperexcitability in Japanese Unverricht-Lundborg disease.Seizure. 2014 Oct;23(9):746-50. doi: 10.1016/j.seizure.2014.06.002. Epub 2014 Jun 25.
• [15] NF-L in cerebrospinal fluid and serum is a biomarker of neuronal damage in an inducible mouse model of neurodegeneration.Neurobiol Dis. 2017 Aug;104:73-84. doi: 10.1016/j.nbd.2017.04.007. Epub 2017 Apr 6.
• [16] Expression of cyclin-dependent kinase 5 mRNA and protein in the human brain following acute ischemic stroke.Brain Pathol. 2007 Jan;17(1):11-23. doi: 10.1111/j.1750-3639.2006.00031.x.
• [17] The protein secretion modulator TMED9 drives CNIH4/TGF/GLI signaling opposing TMED3-WNT-TCF to promote colon cancer metastases.Oncogene. 2019 Jul;38(29):5817-5837. doi: 10.1038/s41388-019-0845-z. Epub 2019 Jun 28.
• [18] Calpastatin, an endogenous calpain-inhibitor protein, regulates the cleavage of the Cdk5 activator p35 to p25.J Neurochem. 2011 May;117(3):504-15. doi: 10.1111/j.1471-4159.2011.07222.x. Epub 2011 Mar 15.
• [19] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [24] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [25] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [26] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [27] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [28] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [29] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [30] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.