Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ3HWTO)

• DOT Name: Complement decay-accelerating factor (CD55)
• Synonyms: CD antigen CD55
• Gene Name: CD55
• Related Disease: Protein-losing enteropathy
• UniProt ID: DAF_HUMAN
• PDB ID: 1H03; 1H04; 1H2P; 1H2Q; 1M11; 1NWV; 1OJV; 1OJW; 1OJY; 1OK1; 1OK2; 1OK3; 1OK9; 1UOT; 1UPN; 2C8I; 2QZD; 2QZF; 2QZH; 3IYP; 3J24; 5FOA; 6ILJ; 6ILK; 6LA5; 7C9W; 7DO4; 7VY5; 7VY6; 8B8R
• Pfam ID: PF00084
• Sequence:
  MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
  ITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
  VGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
  LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER
  DHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
  TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLS
  GHTCFTLTGLLGTLVTMGLLT
• Function: This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage ; (Microbial infection) Acts as a receptor for Coxsackievirus A21, coxsackieviruses B1, B3 and B5; (Microbial infection) Acts as a receptor for Human enterovirus 70 and D68 (Probable); (Microbial infection) Acts as a receptor for Human echoviruses 6, 7, 11, 12, 20 and 21.
• Tissue Specificity: Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.
• KEGG Pathway:
  Complement and coagulation cascades (hsa04610)
  Hematopoietic cell lineage (hsa04640)
  Viral myocarditis (hsa05416)
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  COPI-mediated anterograde transport (R-HSA-6807878)
  Regulation of Complement cascade (R-HSA-977606)
  Class B/2 (Secretin family receptors) (R-HSA-373080)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Protein-losing enteropathy	DISM3WQO	Strong	Autosomal recessive	[1]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Complement decay-accelerating factor (CD55) affects the response to substance of Etoposide.	[36]
Mitoxantrone	DMM39BF	Approved	Complement decay-accelerating factor (CD55) affects the response to substance of Mitoxantrone.	[36]
Methamphetamine	DMPM4SK	Approved	Complement decay-accelerating factor (CD55) affects the response to substance of Methamphetamine.	[37]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Complement decay-accelerating factor (CD55).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Complement decay-accelerating factor (CD55).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Complement decay-accelerating factor (CD55).	[31]

32 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Complement decay-accelerating factor (CD55).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Complement decay-accelerating factor (CD55).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Complement decay-accelerating factor (CD55).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Complement decay-accelerating factor (CD55).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Complement decay-accelerating factor (CD55).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Complement decay-accelerating factor (CD55).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Complement decay-accelerating factor (CD55).	[9]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Complement decay-accelerating factor (CD55).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Complement decay-accelerating factor (CD55).	[11]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Complement decay-accelerating factor (CD55).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Complement decay-accelerating factor (CD55).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Complement decay-accelerating factor (CD55).	[14]
Marinol	DM70IK5	Approved	Marinol increases the expression of Complement decay-accelerating factor (CD55).	[15]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Complement decay-accelerating factor (CD55).	[16]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Complement decay-accelerating factor (CD55).	[17]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Complement decay-accelerating factor (CD55).	[18]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Complement decay-accelerating factor (CD55).	[19]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Complement decay-accelerating factor (CD55).	[20]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Complement decay-accelerating factor (CD55).	[21]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Complement decay-accelerating factor (CD55).	[22]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Complement decay-accelerating factor (CD55).	[23]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Complement decay-accelerating factor (CD55).	[24]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Complement decay-accelerating factor (CD55).	[25]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Complement decay-accelerating factor (CD55).	[27]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Complement decay-accelerating factor (CD55).	[28]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Complement decay-accelerating factor (CD55).	[29]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Complement decay-accelerating factor (CD55).	[30]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Complement decay-accelerating factor (CD55).	[9]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Complement decay-accelerating factor (CD55).	[32]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Complement decay-accelerating factor (CD55).	[33]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Complement decay-accelerating factor (CD55).	[34]
AM251	DMTAWHL	Investigative	AM251 increases the expression of Complement decay-accelerating factor (CD55).	[35]

References

• [1] CD55 Deficiency, Early-Onset Protein-Losing Enteropathy, and Thrombosis. N Engl J Med. 2017 Jul 6;377(1):52-61. doi: 10.1056/NEJMoa1615887. Epub 2017 Jun 28.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [5] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [9] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [10] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [11] A comprehensive analysis of Wnt/beta-catenin signaling pathway-related genes and crosstalk pathways in the treatment of As2O3 in renal cancer. Ren Fail. 2018 Nov;40(1):331-339.
• [12] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [13] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [14] Methotrexate-mediated activation of an AMPK-CREB-dependent pathway: a novel mechanism for vascular protection in chronic systemic inflammation. Ann Rheum Dis. 2016 Feb;75(2):439-48. doi: 10.1136/annrheumdis-2014-206305. Epub 2015 Jan 9.
• [15] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [16] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [17] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [18] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [19] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [20] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [21] Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
• [22] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [23] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [24] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [25] Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
• [26] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [27] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [29] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [30] DON shares a similar mode of action as the ribotoxic stress inducer anisomycin while TBTO shares ER stress patterns with the ER stress inducer thapsigargin based on comparative gene expression profiling in Jurkat T cells. Toxicol Lett. 2014 Jan 30;224(3):395-406. doi: 10.1016/j.toxlet.2013.11.005. Epub 2013 Nov 15.
• [31] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [32] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [33] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [34] Selective aryl hydrocarbon receptor modulator-mediated repression of CD55 expression induced by cytokine exposure. J Pharmacol Exp Ther. 2012 Aug;342(2):345-55. doi: 10.1124/jpet.112.193482. Epub 2012 May 2.
• [35] Cannabinoid derivatives induce cell death in pancreatic MIA PaCa-2 cells via a receptor-independent mechanism. FEBS Lett. 2006 Mar 20;580(7):1733-9.
• [36] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [37] Genome-wide association for methamphetamine dependence: convergent results from 2 samples. Arch Gen Psychiatry. 2008 Mar;65(3):345-55. doi: 10.1001/archpsyc.65.3.345.