General Information of Drug Off-Target (DOT) (ID: OTZ4BG4B)

DOT Name Protein mono-ADP-ribosyltransferase TIPARP (TIPARP)
Synonyms EC 2.4.2.-; ADP-ribosyltransferase diphtheria toxin-like 14; ARTD14; Poly polymerase 7; PARP-7; TCDD-inducible poly polymerase
Gene Name TIPARP
UniProt ID
PARPT_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.4.2.-
Pfam ID
PF00644
Sequence
MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPIL
NTLLESGSLDGVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQ
IPEAHPSTEAPERVVPIQDHSFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDK
VIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGI
EICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVFNDSQEHLERFYCNPENDR
MRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFFCRDHFGWREY
PESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGG
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNL
FHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVD
GICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGS
HGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
Function
ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate, aspartate and cysteine residues on target proteins. Acts as a negative regulator of AHR by mediating mono-ADP-ribosylation of AHR, leading to inhibit transcription activator activity of AHR.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [1]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [24]
------------------------------------------------------------------------------------
37 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [10]
Testosterone DM7HUNW Approved Testosterone increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [10]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [11]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [12]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [13]
Progesterone DMUY35B Approved Progesterone increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [14]
Menadione DMSJDTY Approved Menadione affects the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [9]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [15]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [16]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [6]
Cidofovir DMA13GD Approved Cidofovir increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [6]
Mifepristone DMGZQEF Approved Mifepristone decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [17]
Clodronate DM9Y6X7 Approved Clodronate increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [6]
Lucanthone DMZLBUO Approved Lucanthone increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [18]
Adefovir dipivoxil DMMAWY1 Approved Adefovir dipivoxil increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [6]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [19]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [20]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [21]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [22]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [23]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [25]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [26]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [27]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [28]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [29]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [30]
CH-223191 DMMJZYC Investigative CH-223191 decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [31]
Bilirubin DMI0V4O Investigative Bilirubin increases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [32]
Alpha-naphthoflavone DMELOIQ Investigative Alpha-naphthoflavone decreases the expression of Protein mono-ADP-ribosyltransferase TIPARP (TIPARP). [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 37 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
7 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
8 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
9 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
10 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
13 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
14 Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
15 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
16 In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
17 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
18 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
19 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
20 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
21 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
22 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
23 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
24 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
25 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
26 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
27 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
28 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
29 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
30 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
31 The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
32 Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
33 A human intervention study with foods containing natural Ah-receptor agonists does not significantly show AhR-mediated effects as measured in blood cells and urine. Chem Biol Interact. 2008 Oct 22;176(1):19-29.