Details of the Drug

General Information of Drug (ID: DM1YVZT)

Drug Name
Rituximab
Indication
Disease Entry ICD 11 Status REF
Central nervous system non-hodgkin lymphoma N.A. Approved [1]
Eosinophilic granulomatosis with polyangiitis 4A44.A2 Approved [2]
Hepatosplenic T-cell lymphoma N.A. Approved [3]
Idiopathic thrombocytopenic purpura 3B64.10 Approved [4]
Large granular lymphocytic leukemia 2A90.1 Approved [5]
Leukemia N.A. Approved [6]
Lupus nephritis 4A40.0Y Approved [7]
Lymphoproliferative syndrome N.A. Approved [8]
Lymphosarcoma N.A. Approved [9]
MALT lymphoma N.A. Approved [10]
Nodal marginal zone lymphoma 2A85.0 Approved [11]
Non-hodgkin lymphoma 2B33.5 Approved [12]
Primary cutaneous peripheral T-cell lymphoma not otherwise specified N.A. Approved [13]
Prolymphocytic leukaemia 2A82.1 Approved [14]
Recurrent adult burkitt lymphoma 2A85.6 Approved [15]
Small intestine lymphoma N.A. Approved [16]
Small lymphocytic lymphoma 2A82.0 Approved [17]
Splenic marginal zone lymphoma N.A. Approved [18]
Testicular lymphoma N.A. Approved [19]
Thrombotic thrombocytopenic purpura 3B64.14 Approved [20]
Waldenstrom macroglobulinemia 2A85.4 Approved [21]
Pemphigus vulgaris EB40 Phase 3 [22]
Haematological malignancy 2B33.Y Phase 1 [23]
B-cell neoplasm N.A. Investigative [24]
⏷ Show the Full List of Indication(s)
Drug Type
Antibody
Sequence
>heavy chain chimeric
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY
NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS
AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain chimeric
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
ADMET Property
Absorption Cmax
The maximum plasma concentration (Cmax) of drug is 157-183 mg/L []
Clearance
The clearance of drug is 0.335 L/day in rheumatoid arthritis patients []
Half-life
The concentration or amount of drug in body reduced by one-half in 22 days []
Metabolism
The drug is metabolized via opsonization via the reticuloendothelial system [25]
Vd
The volume of distribution (Vd) of drug is 3.1 L []
Adverse Drug Reaction (ADR)
ADR Term Variation Related DOT DOT ID REF
Adverse drug reaction Not Available TNF OT4IE164 [26]
Adverse drug reaction Not Available CXCL8 OTS7T5VH [26]
Adverse drug reaction Not Available IL6 OTUOSCCU [26]
Cross-matching ID
DrugBank ID
DB00073
TTD ID
D0YM7U
Combinatorial Drugs (CBD) Click to Jump to the Detailed CBD Information of This Drug
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Leukocyte surface antigen Leu-16 (CD20) TTUE541 CD20_HUMAN Not Available [27]

Drug Off-Target (DOT)
DOT Name DOT ID UniProt ID Interaction REF
Interleukin-6 (IL6) OTUOSCCU IL6_HUMAN Drug Response [26]
Interleukin-8 (CXCL8) OTS7T5VH IL8_HUMAN Drug Response [26]
Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) OTOWXCF3 FCG3A_HUMAN Drug Response [28]
Tumor necrosis factor (TNF) OT4IE164 TNFA_HUMAN Drug Response [26]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Rituximab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Rituximab and Roflumilast. Asthma [CA23] [29]
Denosumab DMNI0KO Moderate Additive myelosuppressive effects by the combination of Rituximab and Denosumab. Low bone mass disorder [FB83] [30]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Rituximab and Cladribine. Mature B-cell leukaemia [2A82] [29]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Rituximab and Alemtuzumab. Mature B-cell leukaemia [2A82] [31]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Rituximab and Tecfidera. Multiple sclerosis [8A40] [32]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Rituximab and Siponimod. Multiple sclerosis [8A40] [33]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Rituximab and Fingolimod. Multiple sclerosis [8A40] [34]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Rituximab and Ocrelizumab. Multiple sclerosis [8A40] [35]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Rituximab and Ozanimod. Multiple sclerosis [8A40] [29]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Rituximab and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [36]
Efalizumab DMCKL5V Moderate Additive immunosuppressive effects by the combination of Rituximab and Efalizumab. Psoriasis [EA90] [37]
Upadacitinib DM32B5U Major Additive immunosuppressive effects by the combination of Rituximab and Upadacitinib. Rheumatoid arthritis [FA20] [29]
Canakinumab DM8HLO5 Moderate Additive immunosuppressive effects by the combination of Rituximab and Canakinumab. Rheumatoid arthritis [FA20] [38]
Rilonacept DMGLUQS Moderate Additive immunosuppressive effects by the combination of Rituximab and Rilonacept. Rheumatoid arthritis [FA20] [38]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Rituximab and Golimumab. Rheumatoid arthritis [FA20] [39]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Rituximab when combined with Anthrax vaccine. Sepsis [1G40-1G41] [40]
Azathioprine DMMZSXQ Moderate Additive myelosuppressive effects by the combination of Rituximab and Azathioprine. Transplant rejection [NE84] [33]
Ganciclovir DM1MBYQ Moderate Additive myelosuppressive effects by the combination of Rituximab and Ganciclovir. Virus infection [1A24-1D9Z] [33]
Valganciclovir DMS2IUH Moderate Additive myelosuppressive effects by the combination of Rituximab and Valganciclovir. Virus infection [1A24-1D9Z] [33]
⏷ Show the Full List of 19 DDI Information of This Drug

References

1 How we treat primary central nervous system lymphoma. ESMO Open. 2021 Aug;6(4):100213.
2 Update on eosinophilic granulomatosis with polyangiitis. Allergol Int. 2019 Oct;68(4):430-436.
3 Coexistent hairy cell leukaemia and hepatosplenic T-cell lymphoma: a case report. Diagn Pathol. 2014 Mar 12;9:58.
4 Idiopathic thrombocytopenic purpura (ITP) - new era for an old disease. Rom J Intern Med. 2019 Dec 1;57(4):273-283.
5 Rituximab for rheumatoid arthritis-associated large granular lymphocytic leukemia, a retrospective case series. Semin Arthritis Rheum. 2020 Oct;50(5):1109-1113.
6 Chemoimmunotherapy with hyper-CVAD plus rituximab for the treatment of adult Burkitt and Burkitt-type lymphoma or acute lymphoblastic leukemia. Cancer. 2006 Apr 1;106(7):1569-80.
7 2019 Update of the Joint European League Against Rheumatism and European Renal Association-European Dialysis and Transplant Association (EULAR/ERA-EDTA) recommendations for the management of lupus nephritis. Ann Rheum Dis. 2020 Jun;79(6):713-723.
8 Autoimmune lymphoproliferative syndrome: A disorder of immune dysregulation. Autoimmun Rev. 2023 Nov;22(11):103442.
9 Infusion reactions associated with the therapeutic use of monoclonal antibodies in the treatment of malignancy. Cancer Metastasis Rev. 1999;18(4):465-71.
10 Diagnosis and Treatment for Gastric Mucosa-Associated Lymphoid Tissue (MALT) Lymphoma. J Clin Med. 2022 Dec 23;12(1):120.
11 Nodal marginal zone lymphoma. Leuk Lymphoma. 2014 Jun;55(6):1240-50.
12 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
13 A standard database for drug repositioning. Sci Data. 2017 Mar 14;4:170029.
14 B and T cell prolymphocytic leukaemia. Best Pract Res Clin Haematol. 2019 Sep;32(3):217-228.
15 Burkitt lymphoma - no impact of HIV status on outcomes with rituximab-based chemoimmunotherapy. Leuk Lymphoma. 2023 Mar;64(3):586-596.
16 Metachronous primary cancer of the tongue and malignant lymphoma of the small intestine: A case report. Medicine (Baltimore). 2021 Feb 19;100(7):e24806.
17 Zanubrutinib versus bendamustine and rituximab in untreated chronic lymphocytic leukaemia and small lymphocytic lymphoma (SEQUOIA): a randomised, controlled, phase 3 trial. Lancet Oncol. 2022 Aug;23(8):1031-1043.
18 Treatment of splenic marginal zone lymphoma. Best Pract Res Clin Haematol. 2017 Mar-Jun;30(1-2):139-148.
19 First-line treatment for primary testicular diffuse large B-cell lymphoma with rituximab-CHOP, CNS prophylaxis, and contralateral testis irradiation: final results of an international phase II trial. J Clin Oncol. 2011 Jul 10;29(20):2766-72.
20 Thrombotic Thrombocytopenic Purpura: Pathophysiology, Diagnosis, and Management. J Clin Med. 2021 Feb 2;10(3):536.
21 Waldenstr?m macroglobulinemia: 2023 update on diagnosis, risk stratification, and management. Am J Hematol. 2023 Feb;98(2):348-358.
22 ClinicalTrials.gov (NCT02383589) A Randomized, Double-Blind Study to Evaluate the Efficacy and Safety of Rituximab Versus MMF in Patients With Pemphigus Vulgaris. U.S. National Institutes of Health.
23 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6780).
24 Diffuse Large B-Cell Lymphoma and Related Entities. Dtsch Arztebl Int. 2023 Apr 28;120(17):289-296.
25 Veve MP, Wagner JL: Lefamulin: Review of a Promising Novel Pleuromutilin Antibiotic. Pharmacotherapy. 2018 Sep;38(9):935-946. doi: 10.1002/phar.2166. Epub 2018 Aug 20.
26 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
27 [Contribution of radioimmunotherapy to the treatment of lymphoma]. Ann Pharm Fr. 2008 Nov-Dec;66(5-6):300-8.
28 FCGR3A gene polymorphisms may correlate with response to frontline R-CHOP therapy for diffuse large B-cell lymphoma. Blood. 2006 Oct 15;108(8):2720-5. doi: 10.1182/blood-2006-01-009480. Epub 2006 Apr 11.
29 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
30 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
31 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
32 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
33 Cerner Multum, Inc. "Australian Product Information.".
34 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
35 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
36 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
37 Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
38 Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
39 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
40 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]