Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHQPL7)

• DTT Name: Carbonic anhydrase I (CA-I)
• Synonyms: Carbonic anhydrase B; Carbonic anhydrase 1; Carbonate dehydratase I; CAB
• Gene Name: CA1
• DTT Type: Successful target; [1]
• Related Disease:
  Glaucoma [ICD-11: 9C61]
  Seborrhoeic dermatitis [ICD-11: EA81]
• BioChemical Class: Alpha-carbonic anhydrase
• UniProt ID: CAH1_HUMAN
• TTD ID: T13201
• EC Number: EC 4.2.1.1
• Sequence:
  MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
  INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
  VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
  DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
  PMQHNNRPTQPLKGRTVRASF
• Function: Can hydrates cyanamide to urea. Reversible hydration of carbon dioxide.
• Reactome Pathway:
  Erythrocytes take up oxygen and release carbon dioxide (R-HSA-1247673)
  Reversible hydration of carbon dioxide (R-HSA-1475029)
  Erythrocytes take up carbon dioxide and release oxygen (R-HSA-1237044)
• BioCyc Pathway: MetaCyc:HS05785-MON

Molecular Interaction Atlas (MIA) of This DTT

5 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acetazolamide	DM1AF5U	Glaucoma/ocular hypertension	9C61	Approved	[2]
Dichlorphenamide	DMH7IDQ	Chronic glaucoma	9C61.0Z	Approved	[2]
Ethoxzolamide	DMVO4ED	Glaucoma/ocular hypertension	9C61	Approved	[2]
Methazolamide	DM7J2TA	Glaucoma/ocular hypertension	9C61	Approved	[1]
Salicyclic acid	DM2F8XZ	Seborrhoeic dermatitis	EA81	Approved	[3]

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CG-100649	DMIKMA9	Arthritis	FA20	Phase 3	[4]
Curcumin	DMQPH29	Solid tumour/cancer	2A00-2F9Z	Phase 3	[5]
PARABEN	DMEW5Z8	N. A.	N. A.	Phase 3	[6]
Phenol	DM1QSM3	N. A.	N. A.	Phase 2/3	[5]
Coumate	DMVKW0N	Breast cancer	2C60-2C65	Phase 2	[7]
SULFAMIDE	DMMAS3K	N. A.	N. A.	Phase 1	[8]

1 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ferulic Acid	DMJC7NF	Discovery agent	N.A.	Patented	[6]

178 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(2-bromophenyl)difluoromethanesulfonamide	DMFX9H8	Discovery agent	N.A.	Investigative	[9]
(4-bromophenyl)difluoromethanesulfonamide	DMOCYZJ	Discovery agent	N.A.	Investigative	[9]
1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide	DMNHGVD	Discovery agent	N.A.	Investigative	[10]
1-acetamido-5-sulfonamidoindane	DM92ZCU	Discovery agent	N.A.	Investigative	[11]
1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide	DMUXSH5	Discovery agent	N.A.	Investigative	[10]
1-cyclohexylamido-5-sulfonamidoindane	DMFPQME	Discovery agent	N.A.	Investigative	[12]
1-pentafluorophenylamido-5-sulfonamidoindane	DM9PNTQ	Discovery agent	N.A.	Investigative	[12]
1-valproylamido-5-sulfonamidoindane	DM9ZRU2	Discovery agent	N.A.	Investigative	[12]
2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide	DMG4ITB	Discovery agent	N.A.	Investigative	[13]
2,3-dihydro-1H-indene-5-sulfonamide	DM46MKY	Discovery agent	N.A.	Investigative	[11]
2,4-dichloro-5-sulfamoylbenzoic acid	DM4EY5S	Discovery agent	N.A.	Investigative	[14]
2,4-Disulfamyltrifluoromethylaniline	DM2AW0Z	Discovery agent	N.A.	Investigative	[15]
2-(4-chlorobenzyloxyamino)-N-hydroxyacetamide	DM1JKWL	Discovery agent	N.A.	Investigative	[16]
2-(4-chlorobenzyloxyamino)-N-hydroxyhexanamide	DMFGQ7K	Discovery agent	N.A.	Investigative	[16]
2-(4-chlorobenzyloxyamino)-N-hydroxypropanamide	DMRADWB	Discovery agent	N.A.	Investigative	[16]
2-(biphenyl-4-yl)vinylboronic acid	DMRQOKB	Discovery agent	N.A.	Investigative	[17]
2-acetamido-5-sulfonamidoindane	DMPKBVR	Discovery agent	N.A.	Investigative	[12]
2-Acetylamino-indan-5-sulfonic acid hydrate	DMEQKIU	Discovery agent	N.A.	Investigative	[11]
2-Amino-indan-5-sulfonic acid	DMCUSH1	Discovery agent	N.A.	Investigative	[11]
2-butylamido-5-sulfonamidoindane	DML9MCU	Discovery agent	N.A.	Investigative	[12]
2-cyclohexylamido-5-sulfonamidoindane	DMFBD3K	Discovery agent	N.A.	Investigative	[12]
2-ethylamido-5-sulfonamidoindane	DMDY3JQ	Discovery agent	N.A.	Investigative	[12]
2-Hydroxycinnamic acid	DM86HTZ	Discovery agent	N.A.	Investigative	[5]
2-Mercapto-N-(4-sulfamoyl-phenyl)-benzamide	DMXEUDM	Discovery agent	N.A.	Investigative	[18]
2-Morpholin-4-yl-N-(4-sulfamoyl-phenyl)-acetamide	DMDTRZ2	Discovery agent	N.A.	Investigative	[19]
2-nonylamido-5-sulfonamidoindane	DMOGWIK	Discovery agent	N.A.	Investigative	[12]
2-oxo-2H-chromene-3-carboxylic acid	DMFN769	Discovery agent	N.A.	Investigative	[20]
2-oxo-2H-thiochromene-3-carboxylic acid	DMZTCOM	Discovery agent	N.A.	Investigative	[20]
2-pentafluorophenylamido-5-sulfonamidoindane	DMZ9NCA	Discovery agent	N.A.	Investigative	[12]
2-propylamido-5-sulfonamidoindane	DMG0I25	Discovery agent	N.A.	Investigative	[12]
2-valproylamido-5-sulfonamidoindane	DM8XSE3	Discovery agent	N.A.	Investigative	[12]
3-(3-Phenyl-ureido)-benzenesulfonamide	DM314ZE	Discovery agent	N.A.	Investigative	[13]
3-(4-sulfamoylphenyl)propanoic acid	DMBDW8P	Discovery agent	N.A.	Investigative	[21], [15]
3-bromophenyl-difluoromethanesulfonamide	DMXZW3R	Discovery agent	N.A.	Investigative	[9]
3-Chloro-4-hydrazino-benzenesulfonamide	DMSB5IQ	Discovery agent	N.A.	Investigative	[22]
3-Fluoro-4-hydrazino-benzenesulfonamide	DMLG69R	Discovery agent	N.A.	Investigative	[22]
3-mercapto-N-(4-sulfamoyl-phenyl)-propionamide	DMQ09J8	Discovery agent	N.A.	Investigative	[23]
3-phenyl-5-sulfamoyl-1H-indole-2-carboxamide	DM43CIK	Discovery agent	N.A.	Investigative	[24]
3-phenylprop-1-enylboronic acid	DMIJN9E	Discovery agent	N.A.	Investigative	[17]
4,4'-thiodipyridine-3-sulfonamide	DM0K5JM	Discovery agent	N.A.	Investigative	[25]
4,6-Dinitro salicylic acid	DMIJ4VZ	Discovery agent	N.A.	Investigative	[26]
4-(2-AMINOETHYL)BENZENESULFONAMIDE	DMEK6WX	Discovery agent	N.A.	Investigative	[27]
4-(2-aminopyrimidin-4-ylamino)benzenesulfonamide	DMWG706	Discovery agent	N.A.	Investigative	[15]
4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide	DME6DHX	Discovery agent	N.A.	Investigative	[25]
4-(2-Phenylacetamido)-3-bromobenzenesulfonamide	DMZ62L3	Discovery agent	N.A.	Investigative	[28]
4-(2-Phenylacetamido)-3-chlorobenzenesulfonamide	DM9GOTA	Discovery agent	N.A.	Investigative	[28]
4-(2-Phenylacetamido)-3-fluorobenzenesulfonamide	DMCOD4N	Discovery agent	N.A.	Investigative	[28]
4-(2-Phenylacetamido)benzenesulfonamide	DMFYR6H	Discovery agent	N.A.	Investigative	[28]
4-(2-Phenylacetamidoethyl)benzenesulfonamide	DM1JL03	Discovery agent	N.A.	Investigative	[28]
4-(2-Phenylacetamidomethyl)benzenesulfonamide	DMDYHXE	Discovery agent	N.A.	Investigative	[28]
4-(2-Propynylthio)pyridine-3-sulfonamide	DMT9RAC	Discovery agent	N.A.	Investigative	[25]
4-(2-Pyridin-2-ylacetamido)benzenesulfonamide	DM9LKMP	Discovery agent	N.A.	Investigative	[28]
4-(2-Pyridin-4-ylacetamido)benzenesulfonamide	DMD6AYQ	Discovery agent	N.A.	Investigative	[28]
4-(4-Cyanophenoxy)-3-pyridinesulfonamide	DMNEAJH	Discovery agent	N.A.	Investigative	[25]
4-(4-Fluorophenoxy)-3-pyridinesulfonamide	DMRJLAP	Discovery agent	N.A.	Investigative	[25]
4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide	DMKT20Q	Discovery agent	N.A.	Investigative	[25]
4-(Allylamino)-3-pyridinesulfonamide	DM6MQCI	Discovery agent	N.A.	Investigative	[25]
4-(Carbamolymethylthio)pyridine-3-sulfonamide	DM12R4M	Discovery agent	N.A.	Investigative	[25]
4-(Cyanomethylthio)pyridine-3-sulfonamide	DMZP20H	Discovery agent	N.A.	Investigative	[25]
4-(hydroxymethyl)benzenesulfonamide	DMR6VWL	Discovery agent	N.A.	Investigative	[15]
4-(Methylhydrazino)-3-pyridinesulfonamide	DM4BPL1	Discovery agent	N.A.	Investigative	[25]
4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide	DMYCV8E	Discovery agent	N.A.	Investigative	[25]
4-(Quinolinoxy)-3-pyridinesulfonamide	DMPNXFA	Discovery agent	N.A.	Investigative	[25]
4-Amino-3-bromo-benzenesulfonamide	DMVUCZK	Discovery agent	N.A.	Investigative	[15]
4-Amino-3-chloro-benzenesulfonamide	DMERTQ4	Discovery agent	N.A.	Investigative	[15]
4-Amino-3-fluoro-benzenesulfonamide	DMIQ3VR	Discovery agent	N.A.	Investigative	[29]
4-Amino-3-iodo-benzenesulfonamide	DMCOYHR	Discovery agent	N.A.	Investigative	[15]
4-amino-6-chlorobenzene-1,3-disulfonamide	DMIWGZS	Discovery agent	N.A.	Investigative	[29]
4-amino-N-(4-sulfamoylbenzyl)benzenesulfonamide	DMJZNX6	Discovery agent	N.A.	Investigative	[15]
4-azidobenzenesulfonamide	DM7EQ06	Discovery agent	N.A.	Investigative	[30]
4-Benzenesulfonylamino-benzenesulfonamide	DMC7HKA	Discovery agent	N.A.	Investigative	[13]
4-Benzythiopyridine-3-sulfonamide	DMI1EFY	Discovery agent	N.A.	Investigative	[25]
4-bromophenylboronic acid	DM2YN37	Discovery agent	N.A.	Investigative	[17]
4-butylphenylboronic acid	DMD9FZW	Discovery agent	N.A.	Investigative	[17]
4-Chloro-N-(5-sulfamoyl-indan-2-yl)-benzamide	DM2UYCS	Discovery agent	N.A.	Investigative	[11]
4-Ethoxy-3-pyridinesulfonamide	DM8WAOR	Discovery agent	N.A.	Investigative	[25]
4-ethynyl benzene sulfonamide	DMIF1D6	Discovery agent	N.A.	Investigative	[31]
4-fluoro-N-(4-sulfamoylbenzyl)benzenesulfonamide	DMGBKN7	Discovery agent	N.A.	Investigative	[32]
4-Hydrazino-3-pyridinesulfonamide	DMSZMQU	Discovery agent	N.A.	Investigative	[25]
4-Hydrazino-benzenesulfonamide	DM49B18	Discovery agent	N.A.	Investigative	[22]
4-Hydrazinocarbonyl-benzenesulfonamide	DM8PBEJ	Discovery agent	N.A.	Investigative	[22]
4-isothiocyanatobenzenesulfonamide	DMBK67H	Discovery agent	N.A.	Investigative	[33]
4-Methanesulfonylamino-benzenesulfonamide	DMPH4C8	Discovery agent	N.A.	Investigative	[13]
4-Methoxy-3-pyridinesulfonamide	DMJIX7H	Discovery agent	N.A.	Investigative	[25]
4-methoxyphenylboronic acid	DMP5YFQ	Discovery agent	N.A.	Investigative	[17]
4-methylphenyl-difluoromethanesulfonamide	DMR5NLM	Discovery agent	N.A.	Investigative	[9]
4-methylstyrylboronic acid	DMW0Y29	Discovery agent	N.A.	Investigative	[17]
4-Methylthiopyridine-3-sulfonamide	DMEB5XP	Discovery agent	N.A.	Investigative	[25]
4-nitrophenyl phosphate	DMBX4UJ	Discovery agent	N.A.	Investigative	[34]
4-nitrophenyl-difluoromethanesulfonamide	DM9ETMD	Discovery agent	N.A.	Investigative	[9]
4-phenoxyphenylboronic acid	DMMWYI9	Discovery agent	N.A.	Investigative	[17]
4-[2-(2-Thienyl)acetamidoethyl]benzenesulfonamide	DMH3UPO	Discovery agent	N.A.	Investigative	[28]
4-[2-(2-Thienyl)acetamido]benzenesulfonamide	DMYESXB	Discovery agent	N.A.	Investigative	[28]
4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide	DMGXM9C	Discovery agent	N.A.	Investigative	[13]
5-Amino-[1,3,4]thiadiazole-2-thiol	DMGA47N	Discovery agent	N.A.	Investigative	[35]
5-Chlorosalicylic Acid	DMH397E	Discovery agent	N.A.	Investigative	[26]
5-hydroxy-1-tosyl-1H-pyrrol-2(5H)-one	DM5RI4H	Discovery agent	N.A.	Investigative	[36]
5-oxo-1-tosyl-2,5-dihydro-1Hpyrrol-2-yl acetate	DMQ94BX	Discovery agent	N.A.	Investigative	[36]
6-(aminomethyl)-2H-chromen-2-one	DMJU9TG	Discovery agent	N.A.	Investigative	[20]
6-Amino-benzothiazole-2-sulfonic acid amide	DMWPELS	Discovery agent	N.A.	Investigative	[37]
6-Hydroxy-benzothiazole-2-sulfonic acid amide	DM2B4S5	Discovery agent	N.A.	Investigative	[38]
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid	DM7WH82	Discovery agent	N.A.	Investigative	[20]
6-methyl-2-oxo-2H-chromene-3-carboxylic acid	DMZ6HQL	Discovery agent	N.A.	Investigative	[20]
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid	DMJITU0	Discovery agent	N.A.	Investigative	[20]
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid	DMHCWY8	Discovery agent	N.A.	Investigative	[20]
Aminobenzolamide derivative	DMWYS0Z	Discovery agent	N.A.	Investigative	[39]
Azide	DM5XZYB	Discovery agent	N.A.	Investigative	[40]
BENZENESULFONAMIDE	DM3I8A1	Discovery agent	N.A.	Investigative	[41]
BENZOLAMIDE	DME5QPX	Discovery agent	N.A.	Investigative	[15]
Benzothiazole-2-sulfonic acid amide	DMROP5Q	Discovery agent	N.A.	Investigative	[42]
Beta-naphthylboronic acid	DMZ8Y67	Discovery agent	N.A.	Investigative	[17]
Biphenyl-4-ylboronic acid	DMIHMP5	Discovery agent	N.A.	Investigative	[17]
Carbamoyl phosphate disodium	DMZYK1W	Discovery agent	N.A.	Investigative	[43]
Carzenide	DMVD481	Discovery agent	N.A.	Investigative	[41]
CATECHIN	DMY38SB	Discovery agent	N.A.	Investigative	[5]
CL-5343	DM9AFZ3	Solid tumour/cancer	2A00-2F9Z	Investigative	[1], [44]
Coumarin	DM0N8ZM	Discovery agent	N.A.	Investigative	[45]
CYANATE	DM6HQDL	Discovery agent	N.A.	Investigative	[40]
Cynooxide anion	DMZCA15	Discovery agent	N.A.	Investigative	[46]
Decane-1,10-diyl disulfamate	DM1ESVR	Discovery agent	N.A.	Investigative	[47]
Decyl sulfamate	DMIERWO	Discovery agent	N.A.	Investigative	[47]
ELLAGIC ACID	DMX8BS5	Discovery agent	N.A.	Investigative	[6]
ETHYL 3-[4-(AMINOSULFONYL)PHENYL]PROPANOATE	DMKJGLO	Discovery agent	N.A.	Investigative	[21]
GALLICACID	DM6Y3A0	Discovery agent	N.A.	Investigative	[6]
HERNIARIN	DM9UASM	Discovery agent	N.A.	Investigative	[20]
Hexane-1,6-diamine	DMSHF0K	Discovery agent	N.A.	Investigative	[48]
HYDROSULFIDE	DMO32HN	Discovery agent	N.A.	Investigative	[40]
IODIDE	DM3FZ6P	Discovery agent	N.A.	Investigative	[8]
L-693612	DMMUYHX	Glaucoma/ocular hypertension	9C61	Investigative	[49], [50]
N-(4-cyanophenyl)sulfamide	DMW8S2D	Discovery agent	N.A.	Investigative	[51]
N-(4-Sulfamoyl-phenyl)-benzamide	DMZDACT	Discovery agent	N.A.	Investigative	[13]
N-(4-Sulfamoyl-phenyl)-butyramide	DM3FW9Q	Discovery agent	N.A.	Investigative	[13]
N-(4-Sulfamoyl-phenyl)-propionamide	DM7MHQD	Discovery agent	N.A.	Investigative	[13]
N-(4-sulfamoylphenylethyl)-4-sulfamoylbenzamide	DM7QX03	Discovery agent	N.A.	Investigative	[52]
N-(5-ethyl-1,3,4-thiadiazol-2-yl)sulfamide	DMNQDLC	Discovery agent	N.A.	Investigative	[53]
N-(5-Mercapto-[1,3,4]thiadiazol-2-yl)-acetamide	DMSQEXP	Discovery agent	N.A.	Investigative	[35]
N-(5-phenyl-1,3,4-thiadiazol-2-yl)sulfamide	DMA21WB	Discovery agent	N.A.	Investigative	[53]
N-(5-tert-butyl-1,3,4-thiadiazol-2-yl)sulfamide	DM5E7OC	Discovery agent	N.A.	Investigative	[53]
N-(pentafluorophenyl)sulfamide	DME45J8	Discovery agent	N.A.	Investigative	[51]
N-1,3,4-thiadiazol-2-ylsulfamide	DMJ10WH	Discovery agent	N.A.	Investigative	[53]
N-hydroxysulfamide	DMTDBMU	Discovery agent	N.A.	Investigative	[54]
N-hydroxysulfonamides	DMJBC03	Discovery agent	N.A.	Investigative	[55]
N-propynyl amidebenzenesulphonide	DMWTPJH	Discovery agent	N.A.	Investigative	[56]
N-[4-(trifluoromethyl)phenyl]sulfamide	DMMX65T	Discovery agent	N.A.	Investigative	[51]
N-[5-(ethylthio)-1,3,4-thiadiazol-2-yl]sulfamide	DMSI4PE	Discovery agent	N.A.	Investigative	[53]
N-[5-(methylthio)-1,3,4-thiadiazol-2-yl]sulfamide	DMXLJGR	Discovery agent	N.A.	Investigative	[53]
N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE	DMX4QKU	Discovery agent	N.A.	Investigative	[21]
Nitrate	DMVFB93	Discovery agent	N.A.	Investigative	[8]
NSC-654077	DMW3QAK	Discovery agent	N.A.	Investigative	[18]
Octane-1,8-diyl disulfamate	DMBQMGH	Discovery agent	N.A.	Investigative	[47]
Octyl sulfamate	DM40ZCA	Discovery agent	N.A.	Investigative	[47]
P-Coumaric Acid	DMGJSVD	Discovery agent	N.A.	Investigative	[6]
Paraoxon	DMN4ZKC	Discovery agent	N.A.	Investigative	[34]
Pentane-1,5-diamine	DMVPZG9	Discovery agent	N.A.	Investigative	[48]
Pentanoic acid (4-sulfamoyl-phenyl)-amide	DMAZ07T	Discovery agent	N.A.	Investigative	[13]
Phenethylboronic acid	DMPDVG2	Discovery agent	N.A.	Investigative	[17]
Phenoxyarsonous acid	DMZJO5V	Discovery agent	N.A.	Investigative	[8]
Phenyl Boronic acid	DMFZH49	Discovery agent	N.A.	Investigative	[8]
PHENYLDIFLUOROMETHANESULFONAMIDE	DME75VC	Discovery agent	N.A.	Investigative	[9]
PHENYLMETHANESULFONAMIDE	DMGLDFI	Discovery agent	N.A.	Investigative	[9]
PHENYLSULFAMATE	DMRLFJV	Discovery agent	N.A.	Investigative	[9]
Prop-2-ynyl 4-sulfamoylbenzoate	DM8O41M	Discovery agent	N.A.	Investigative	[56]
Saccharin	DMRA736	Discovery agent	N.A.	Investigative	[29]
Sodium trithiocarbonate	DM6WYGC	Discovery agent	N.A.	Investigative	[57]
Styrylboronic acid	DMJ4Z7W	Discovery agent	N.A.	Investigative	[17]
SULFAMATE	DMF1589	Discovery agent	N.A.	Investigative	[8]
Sulfamic acid 12-sulfamoyloxy-dodecyl ester	DM9XNSK	Discovery agent	N.A.	Investigative	[58]
Sulfamic acid 16-sulfamoyloxy-hexadecyl ester	DM7VBSY	Discovery agent	N.A.	Investigative	[58]
Sulfamic acid 3-sulfamoyloxy-phenyl ester	DMA0MEV	Discovery agent	N.A.	Investigative	[58]
Sulfamic acid 4-sulfamoyloxy-butyl ester	DMQZGNJ	Discovery agent	N.A.	Investigative	[58]
Sulfamic acid 6-sulfamoyloxy-hexyl ester	DMT3U2D	Discovery agent	N.A.	Investigative	[58]
Sulfamic acid 7-sulfamoyloxy-heptyl ester	DMVWEN3	Discovery agent	N.A.	Investigative	[58]
Sulfate	DMW0ZBF	Discovery agent	N.A.	Investigative	[8]
Syringic Acid	DM802V7	Discovery agent	N.A.	Investigative	[6]
Thioureido sulfonamide	DM8WYEM	Discovery agent	N.A.	Investigative	[59]
Trecadrine	DMDX0VI	Discovery agent	N.A.	Investigative	[60]
[Au(CN)2]-	DMN70VT	Discovery agent	N.A.	Investigative	[61]
[Cu(CN)2]-	DMV6NP1	Discovery agent	N.A.	Investigative	[61]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Breast cancer	2C82	Breast tissue	5.23E-14	-0.11	-0.41
Rheumatoid arthritis	FA20	Synovial tissue	1.15E-01	-0.08	-0.33

References

• [1] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2597).
• [2] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [3] Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem. 2008 Aug 1;16(15):7424-8.
• [4] Understanding the Dual Inhibition of COX-2 and Carbonic Anhydrase-II by Celecoxib and CG100649 Using Density Functional Theory Calculations and other Molecular Modelling Approaches. Protein Pept Lett. 2015;22(10):903-12.
• [5] Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3.
• [6] Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. Bioorg Med Chem. 2010 Mar 15;18(6):2159-2164.
• [7] Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-r... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6.
• [8] Carbonic anhydrase inhibitors. Inhibition of the newly isolated murine isozyme XIII with anions. Bioorg Med Chem Lett. 2004 Nov 1;14(21):5435-9.
• [9] Carbonic anhydrase inhibitors: inhibition of the human isozymes I, II, VA, and IX with a library of substituted difluoromethanesulfonamides. Bioorg Med Chem Lett. 2005 Dec 1;15(23):5192-6.
• [10] Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the... Eur J Med Chem. 2010 Sep;45(9):3656-61.
• [11] Carbonic anhydrase inhibitors. Design of anticonvulsant sulfonamides incorporating indane moieties. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5781-6.
• [12] Indanesulfonamides as carbonic anhydrase inhibitors. Toward structure-based design of selective inhibitors of the tumor-associated isozyme CA IX. J Med Chem. 2006 May 4;49(9):2743-9.
• [13] Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.
• [14] Synthesis, characterization and antiglaucoma activity of a novel proton transfer compound and a mixed-ligand Zn(II) complex. Bioorg Med Chem. 2010 Jan 15;18(2):930-8.
• [15] Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. Bioorg Med Chem. 2009 Jul 15;17(14):5054-8.
• [16] Carbonic anhydrase and matrix metalloproteinase inhibitors. Inhibition of human tumor-associated isozymes IX and cytosolic isozyme I and II with su... Bioorg Med Chem. 2007 Mar 15;15(6):2298-311.
• [17] Carbonic anhydrase inhibitors. Inhibition of the fungal beta-carbonic anhydrases from Candida albicans and Cryptococcus neoformans with boronic acids. Bioorg Med Chem Lett. 2009 May 15;19(10):2642-5.
• [18] Recent developments of carbonic anhydrase inhibitors as potential anticancer drugs. J Med Chem. 2008 Jun 12;51(11):3051-6.
• [19] Carbonic anhydrase inhibitors. Novel sulfanilamide/acetazolamide derivatives obtained by the tail approach and their interaction with the cytosolic... Bioorg Med Chem Lett. 2005 Jan 17;15(2):367-72.
• [20] Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem. 2010 Jan 14;53(1):335-44.
• [21] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [22] Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/membrane-associated carbonic anhydrase isozymes I, II, and IX with sulfonamide... J Med Chem. 2005 Mar 24;48(6):2121-5.
• [23] Carbonic anhydrase inhibitors: Hypoxia-activatable sulfonamides incorporating disulfide bonds that target the tumor-associated isoform IX. J Med Chem. 2006 Sep 7;49(18):5544-51.
• [24] Discovery of low nanomolar and subnanomolar inhibitors of the mycobacterial beta-carbonic anhydrases Rv1284 and Rv3273. J Med Chem. 2009 Jul 9;52(13):4063-7.
• [25] Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associa... Eur J Med Chem. 2010 Jun;45(6):2396-404.
• [26] In vitro inhibition of salicylic acid derivatives on human cytosolic carbonic anhydrase isozymes I and II. Bioorg Med Chem. 2008 Oct 15;16(20):9101-5.
• [27] Carbonic anhydrase inhibitors. Design of fluorescent sulfonamides as probes of tumor-associated carbonic anhydrase IX that inhibit isozyme IX-media... J Med Chem. 2005 Jul 28;48(15):4834-41.
• [28] Carbonic anhydrase inhibitors. Aromatic/heterocyclic sulfonamides incorporating phenacetyl, pyridylacetyl and thienylacetyl tails act as potent inh... Bioorg Med Chem. 2009 Jul 15;17(14):4894-9.
• [29] Mutation of Phe91 to Asn in human carbonic anhydrase I unexpectedly enhanced both catalytic activity and affinity for sulfonamide inhibitors. Bioorg Med Chem. 2010 Aug 1;18(15):5498-503.
• [30] Inhibition of human mitochondrial carbonic anhydrases VA and VB with para-(4-phenyltriazole-1-yl)-benzenesulfonamide derivatives. Bioorg Med Chem Lett. 2008 Aug 15;18(16):4624-7.
• [31] Inhibition of carbonic anhydrases with glycosyltriazole benzene sulfonamides. J Med Chem. 2008 Mar 27;51(6):1945-53.
• [32] Ligand-based and structure-based virtual screening to identify carbonic anhydrase IX inhibitors. Bioorg Med Chem. 2009 Jan 15;17(2):553-7.
• [33] Carbonic anhydrase inhibitors: the first on-resin screening of a 4-sulfamoylphenylthiourea library. J Med Chem. 2004 Oct 7;47(21):5224-9.
• [34] Paraoxon, 4-nitrophenyl phosphate and acetate are substrates of - but not of -, - and -carbonic anhydrases. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6208-12.
• [35] Carbonic anhydrase inhibitors. Inhibition of the cytosolic and tumor-associated carbonic anhydrase isozymes I, II, and IX with a series of 1,3,4-th... Bioorg Med Chem Lett. 2005 May 2;15(9):2347-52.
• [36] A novel and one-pot synthesis of new 1-tosyl pyrrol-2-one derivatives and analysis of carbonic anhydrase inhibitory potencies. Bioorg Med Chem. 2010 Jun 15;18(12):4468-74.
• [37] Carbonic anhydrase inhibitors. Synthesis of water-soluble, topically effective, intraocular pressure-lowering aromatic/heterocyclic sulfonamides co... J Med Chem. 1999 Jul 15;42(14):2641-50.
• [38] Cloning, expression, post-translational modifications and inhibition studies on the latest mammalian carbonic anhydrase isoform, CA XV. J Med Chem. 2009 Feb 12;52(3):646-54.
• [39] Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides d... Bioorg Med Chem Lett. 2004 Dec 6;14(23):5775-80.
• [40] Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5769-73.
• [41] Ligand-directed tosyl chemistry for protein labeling in vivo. Nat Chem Biol. 2009 May;5(5):341-3.
• [42] Carbonic anhydrase inhibitors. Inhibition of the human cytosolic isozyme VII with aromatic and heterocyclic sulfonamides. Bioorg Med Chem Lett. 2005 Feb 15;15(4):971-6.
• [43] Carbonic anhydrase inhibitors. Interaction of isozymes I, II, IV, V, and IX with phosphates, carbamoyl phosphate, and the phosphonate antiviral dru... Bioorg Med Chem Lett. 2004 Dec 6;14(23):5763-7.
• [44] Synthesis, characterization and antiglaucoma activity of some novel pyrazole derivatives of 5-amino-1,3,4-thiadiazole-2-sulfonamide. Eur J Med Chem. 2010 Nov;45(11):4769-73.
• [45] 7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and X... Bioorg Med Chem Lett. 2010 Dec 15;20(24):7255-8.
• [46] Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4563-7.
• [47] Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-bi... J Med Chem. 2009 Oct 8;52(19):5990-8.
• [48] Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem. 2010 Aug 12;53(15):5511-22.
• [49] Dose-dependent pharmacokinetics of L-693,612, a carbonic anhydrase inhibitor, following oral administration in rats. Pharm Res. 1994 Mar;11(3):438-41.
• [50] Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36.
• [51] Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxy... Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8.
• [52] Pteridine-sulfonamide conjugates as dual inhibitors of carbonic anhydrases and dihydrofolate reductase with potential antitumor activity. Bioorg Med Chem. 2010 Jul 15;18(14):5081-9.
• [53] Carbonic anhydrase inhibitors: 2-substituted-1,3,4-thiadiazole-5-sulfamides act as powerful and selective inhibitors of the mitochondrial isozymes ... Bioorg Med Chem Lett. 2008 Dec 15;18(24):6332-5.
• [54] Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mamm... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5.
• [55] Carbonic anhydrase inhibitors: inhibition of isozymes I, II and IV with N-hydroxysulfonamides--a novel class of intraocular pressure lowering agents. J Enzyme Inhib. 1998 Jul;13(4):267-84.
• [56] A novel class of carbonic anhydrase inhibitors: glycoconjugate benzene sulfonamides prepared by "click-tailing". J Med Chem. 2006 Nov 2;49(22):6539-48.
• [57] Carbonic anhydrase inhibitors. Inhibition of cytosolic isoforms I, II, III, VII and XIII with less investigated inorganic anions. Bioorg Med Chem Lett. 2009 Apr 1;19(7):1855-7.
• [58] Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with bis-sulfamates. Bioorg Med Chem Lett. 2005 Feb 1;15(3):579-84.
• [59] Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowe... Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.
• [60] Sulfenamido-sulfonamides as inhibitors of carbonic anhydrase isozymes I, II and IV. J Enzyme Inhib. 1997 Aug;12(3):175-90.
• [61] Carbonic anhydrase inhibitors. Inhibition of isozymes I, II, IV, V and IX with complex fluorides, chlorides and cyanides. Bioorg Med Chem Lett. 2005 Apr 1;15(7):1909-13.