General Information of Drug Therapeutic Target (DTT) (ID: TTHQPL7)

DTT Name Carbonic anhydrase I (CA-I)
Synonyms Carbonic anhydrase B; Carbonic anhydrase 1; Carbonate dehydratase I; CAB
Gene Name CA1
DTT Type
Successful target
[1]
BioChemical Class
Alpha-carbonic anhydrase
UniProt ID
CAH1_HUMAN
TTD ID
T13201
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 4.2.1.1
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Function Can hydrates cyanamide to urea. Reversible hydration of carbon dioxide.
KEGG Pathway
Nitrogen metabolism (hsa00910 )
Reactome Pathway
Erythrocytes take up oxygen and release carbon dioxide (R-HSA-1247673 )
Reversible hydration of carbon dioxide (R-HSA-1475029 )
Erythrocytes take up carbon dioxide and release oxygen (R-HSA-1237044 )
BioCyc Pathway
MetaCyc:HS05785-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
5 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acetazolamide DM1AF5U Absence epilepsy Approved [2]
Dichlorphenamide DMH7IDQ Chronic glaucoma 9C61.0Z Approved [2]
Ethoxzolamide DMVO4ED Glaucoma/ocular hypertension 9C61 Approved [2]
Methazolamide DM7J2TA Glaucoma/ocular hypertension 9C61 Approved [1]
Salicyclic acid DM2F8XZ Acne vulgaris ED80 Approved [3]
------------------------------------------------------------------------------------
6 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CG-100649 DMIKMA9 Arthritis FA20 Phase 3 [4]
Curcumin DMQPH29 Solid tumour/cancer 2A00-2F9Z Phase 3 [5]
PARABEN DMEW5Z8 N. A. N. A. Phase 3 [6]
PHENOL DM1QSM3 N. A. N. A. Phase 2/3 [5]
Coumate DMVKW0N Breast cancer 2C60-2C65 Phase 2 [7]
SULFAMIDE DMMAS3K N. A. N. A. Phase 1 [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Clinical Trial Drug(s)
1 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
FERULIC ACID DMJC7NF Discovery agent N.A. Patented [6]
------------------------------------------------------------------------------------
178 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(2-bromophenyl)difluoromethanesulfonamide DMFX9H8 Discovery agent N.A. Investigative [9]
(4-bromophenyl)difluoromethanesulfonamide DMOCYZJ Discovery agent N.A. Investigative [9]
1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide DMNHGVD Discovery agent N.A. Investigative [10]
1-acetamido-5-sulfonamidoindane DM92ZCU Discovery agent N.A. Investigative [11]
1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide DMUXSH5 Discovery agent N.A. Investigative [10]
1-cyclohexylamido-5-sulfonamidoindane DMFPQME Discovery agent N.A. Investigative [12]
1-pentafluorophenylamido-5-sulfonamidoindane DM9PNTQ Discovery agent N.A. Investigative [12]
1-valproylamido-5-sulfonamidoindane DM9ZRU2 Discovery agent N.A. Investigative [12]
2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide DMG4ITB Discovery agent N.A. Investigative [13]
2,3-dihydro-1H-indene-5-sulfonamide DM46MKY Discovery agent N.A. Investigative [11]
2,4-dichloro-5-sulfamoylbenzoic acid DM4EY5S Discovery agent N.A. Investigative [14]
2,4-Disulfamyltrifluoromethylaniline DM2AW0Z Discovery agent N.A. Investigative [15]
2-(4-chlorobenzyloxyamino)-N-hydroxyacetamide DM1JKWL Discovery agent N.A. Investigative [16]
2-(4-chlorobenzyloxyamino)-N-hydroxyhexanamide DMFGQ7K Discovery agent N.A. Investigative [16]
2-(4-chlorobenzyloxyamino)-N-hydroxypropanamide DMRADWB Discovery agent N.A. Investigative [16]
2-(biphenyl-4-yl)vinylboronic acid DMRQOKB Discovery agent N.A. Investigative [17]
2-acetamido-5-sulfonamidoindane DMPKBVR Discovery agent N.A. Investigative [12]
2-Acetylamino-indan-5-sulfonic acid hydrate DMEQKIU Discovery agent N.A. Investigative [11]
2-Amino-indan-5-sulfonic acid DMCUSH1 Discovery agent N.A. Investigative [11]
2-butylamido-5-sulfonamidoindane DML9MCU Discovery agent N.A. Investigative [12]
2-cyclohexylamido-5-sulfonamidoindane DMFBD3K Discovery agent N.A. Investigative [12]
2-ethylamido-5-sulfonamidoindane DMDY3JQ Discovery agent N.A. Investigative [12]
2-Hydroxycinnamic acid DM86HTZ Discovery agent N.A. Investigative [5]
2-Mercapto-N-(4-sulfamoyl-phenyl)-benzamide DMXEUDM Discovery agent N.A. Investigative [18]
2-Morpholin-4-yl-N-(4-sulfamoyl-phenyl)-acetamide DMDTRZ2 Discovery agent N.A. Investigative [19]
2-nonylamido-5-sulfonamidoindane DMOGWIK Discovery agent N.A. Investigative [12]
2-oxo-2H-chromene-3-carboxylic acid DMFN769 Discovery agent N.A. Investigative [20]
2-oxo-2H-thiochromene-3-carboxylic acid DMZTCOM Discovery agent N.A. Investigative [20]
2-pentafluorophenylamido-5-sulfonamidoindane DMZ9NCA Discovery agent N.A. Investigative [12]
2-propylamido-5-sulfonamidoindane DMG0I25 Discovery agent N.A. Investigative [12]
2-valproylamido-5-sulfonamidoindane DM8XSE3 Discovery agent N.A. Investigative [12]
3-(3-Phenyl-ureido)-benzenesulfonamide DM314ZE Discovery agent N.A. Investigative [13]
3-(4-sulfamoylphenyl)propanoic acid DMBDW8P Discovery agent N.A. Investigative [21]
3-bromophenyl-difluoromethanesulfonamide DMXZW3R Discovery agent N.A. Investigative [9]
3-Chloro-4-hydrazino-benzenesulfonamide DMSB5IQ Discovery agent N.A. Investigative [22]
3-Fluoro-4-hydrazino-benzenesulfonamide DMLG69R Discovery agent N.A. Investigative [22]
3-mercapto-N-(4-sulfamoyl-phenyl)-propionamide DMQ09J8 Discovery agent N.A. Investigative [23]
3-phenyl-5-sulfamoyl-1H-indole-2-carboxamide DM43CIK Discovery agent N.A. Investigative [24]
3-phenylprop-1-enylboronic acid DMIJN9E Discovery agent N.A. Investigative [17]
4,4'-thiodipyridine-3-sulfonamide DM0K5JM Discovery agent N.A. Investigative [25]
4,6-Dinitro salicylic acid DMIJ4VZ Discovery agent N.A. Investigative [26]
4-(2-AMINOETHYL)BENZENESULFONAMIDE DMEK6WX Discovery agent N.A. Investigative [27]
4-(2-aminopyrimidin-4-ylamino)benzenesulfonamide DMWG706 Discovery agent N.A. Investigative [15]
4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide DME6DHX Discovery agent N.A. Investigative [25]
4-(2-Phenylacetamido)-3-bromobenzenesulfonamide DMZ62L3 Discovery agent N.A. Investigative [28]
4-(2-Phenylacetamido)-3-chlorobenzenesulfonamide DM9GOTA Discovery agent N.A. Investigative [28]
4-(2-Phenylacetamido)-3-fluorobenzenesulfonamide DMCOD4N Discovery agent N.A. Investigative [28]
4-(2-Phenylacetamido)benzenesulfonamide DMFYR6H Discovery agent N.A. Investigative [28]
4-(2-Phenylacetamidoethyl)benzenesulfonamide DM1JL03 Discovery agent N.A. Investigative [28]
4-(2-Phenylacetamidomethyl)benzenesulfonamide DMDYHXE Discovery agent N.A. Investigative [28]
4-(2-Propynylthio)pyridine-3-sulfonamide DMT9RAC Discovery agent N.A. Investigative [25]
4-(2-Pyridin-2-ylacetamido)benzenesulfonamide DM9LKMP Discovery agent N.A. Investigative [28]
4-(2-Pyridin-4-ylacetamido)benzenesulfonamide DMD6AYQ Discovery agent N.A. Investigative [28]
4-(4-Cyanophenoxy)-3-pyridinesulfonamide DMNEAJH Discovery agent N.A. Investigative [25]
4-(4-Fluorophenoxy)-3-pyridinesulfonamide DMRJLAP Discovery agent N.A. Investigative [25]
4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide DMKT20Q Discovery agent N.A. Investigative [25]
4-(Allylamino)-3-pyridinesulfonamide DM6MQCI Discovery agent N.A. Investigative [25]
4-(Carbamolymethylthio)pyridine-3-sulfonamide DM12R4M Discovery agent N.A. Investigative [25]
4-(Cyanomethylthio)pyridine-3-sulfonamide DMZP20H Discovery agent N.A. Investigative [25]
4-(hydroxymethyl)benzenesulfonamide DMR6VWL Discovery agent N.A. Investigative [15]
4-(Methylhydrazino)-3-pyridinesulfonamide DM4BPL1 Discovery agent N.A. Investigative [25]
4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide DMYCV8E Discovery agent N.A. Investigative [25]
4-(Quinolinoxy)-3-pyridinesulfonamide DMPNXFA Discovery agent N.A. Investigative [25]
4-Amino-3-bromo-benzenesulfonamide DMVUCZK Discovery agent N.A. Investigative [15]
4-Amino-3-chloro-benzenesulfonamide DMERTQ4 Discovery agent N.A. Investigative [15]
4-Amino-3-fluoro-benzenesulfonamide DMIQ3VR Discovery agent N.A. Investigative [29]
4-Amino-3-iodo-benzenesulfonamide DMCOYHR Discovery agent N.A. Investigative [15]
4-amino-6-chlorobenzene-1,3-disulfonamide DMIWGZS Discovery agent N.A. Investigative [29]
4-amino-N-(4-sulfamoylbenzyl)benzenesulfonamide DMJZNX6 Discovery agent N.A. Investigative [15]
4-azidobenzenesulfonamide DM7EQ06 Discovery agent N.A. Investigative [30]
4-Benzenesulfonylamino-benzenesulfonamide DMC7HKA Discovery agent N.A. Investigative [13]
4-Benzythiopyridine-3-sulfonamide DMI1EFY Discovery agent N.A. Investigative [25]
4-bromophenylboronic acid DM2YN37 Discovery agent N.A. Investigative [17]
4-butylphenylboronic acid DMD9FZW Discovery agent N.A. Investigative [17]
4-Chloro-N-(5-sulfamoyl-indan-2-yl)-benzamide DM2UYCS Discovery agent N.A. Investigative [11]
4-Ethoxy-3-pyridinesulfonamide DM8WAOR Discovery agent N.A. Investigative [25]
4-ethynyl benzene sulfonamide DMIF1D6 Discovery agent N.A. Investigative [31]
4-fluoro-N-(4-sulfamoylbenzyl)benzenesulfonamide DMGBKN7 Discovery agent N.A. Investigative [32]
4-Hydrazino-3-pyridinesulfonamide DMSZMQU Discovery agent N.A. Investigative [25]
4-Hydrazino-benzenesulfonamide DM49B18 Discovery agent N.A. Investigative [22]
4-Hydrazinocarbonyl-benzenesulfonamide DM8PBEJ Discovery agent N.A. Investigative [22]
4-isothiocyanatobenzenesulfonamide DMBK67H Discovery agent N.A. Investigative [33]
4-Methanesulfonylamino-benzenesulfonamide DMPH4C8 Discovery agent N.A. Investigative [13]
4-Methoxy-3-pyridinesulfonamide DMJIX7H Discovery agent N.A. Investigative [25]
4-methoxyphenylboronic acid DMP5YFQ Discovery agent N.A. Investigative [17]
4-methylphenyl-difluoromethanesulfonamide DMR5NLM Discovery agent N.A. Investigative [9]
4-methylstyrylboronic acid DMW0Y29 Discovery agent N.A. Investigative [17]
4-Methylthiopyridine-3-sulfonamide DMEB5XP Discovery agent N.A. Investigative [25]
4-nitrophenyl phosphate DMBX4UJ Discovery agent N.A. Investigative [34]
4-nitrophenyl-difluoromethanesulfonamide DM9ETMD Discovery agent N.A. Investigative [9]
4-phenoxyphenylboronic acid DMMWYI9 Discovery agent N.A. Investigative [17]
4-[2-(2-Thienyl)acetamidoethyl]benzenesulfonamide DMH3UPO Discovery agent N.A. Investigative [28]
4-[2-(2-Thienyl)acetamido]benzenesulfonamide DMYESXB Discovery agent N.A. Investigative [28]
4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide DMGXM9C Discovery agent N.A. Investigative [13]
5-Amino-[1,3,4]thiadiazole-2-thiol DMGA47N Discovery agent N.A. Investigative [35]
5-Chlorosalicylic Acid DMH397E Discovery agent N.A. Investigative [26]
5-hydroxy-1-tosyl-1H-pyrrol-2(5H)-one DM5RI4H Discovery agent N.A. Investigative [36]
5-oxo-1-tosyl-2,5-dihydro-1Hpyrrol-2-yl acetate DMQ94BX Discovery agent N.A. Investigative [36]
6-(aminomethyl)-2H-chromen-2-one DMJU9TG Discovery agent N.A. Investigative [20]
6-Amino-benzothiazole-2-sulfonic acid amide DMWPELS Discovery agent N.A. Investigative [37]
6-Hydroxy-benzothiazole-2-sulfonic acid amide DM2B4S5 Discovery agent N.A. Investigative [38]
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid DM7WH82 Discovery agent N.A. Investigative [20]
6-methyl-2-oxo-2H-chromene-3-carboxylic acid DMZ6HQL Discovery agent N.A. Investigative [20]
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid DMJITU0 Discovery agent N.A. Investigative [20]
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid DMHCWY8 Discovery agent N.A. Investigative [20]
Aminobenzolamide derivative DMWYS0Z Discovery agent N.A. Investigative [39]
Azide DM5XZYB Discovery agent N.A. Investigative [40]
BENZENESULFONAMIDE DM3I8A1 Discovery agent N.A. Investigative [41]
BENZOLAMIDE DME5QPX Discovery agent N.A. Investigative [15]
Benzothiazole-2-sulfonic acid amide DMROP5Q Discovery agent N.A. Investigative [42]
Beta-naphthylboronic acid DMZ8Y67 Discovery agent N.A. Investigative [17]
Biphenyl-4-ylboronic acid DMIHMP5 Discovery agent N.A. Investigative [17]
Carbamoyl phosphate disodium DMZYK1W Discovery agent N.A. Investigative [43]
Carzenide DMVD481 Discovery agent N.A. Investigative [41]
CATECHIN DMY38SB Discovery agent N.A. Investigative [5]
CL-5343 DM9AFZ3 Solid tumour/cancer 2A00-2F9Z Investigative [1]
COUMARIN DM0N8ZM Discovery agent N.A. Investigative [44]
CYANATE DM6HQDL Discovery agent N.A. Investigative [40]
Cynooxide anion DMZCA15 Discovery agent N.A. Investigative [45]
Decane-1,10-diyl disulfamate DM1ESVR Discovery agent N.A. Investigative [46]
Decyl sulfamate DMIERWO Discovery agent N.A. Investigative [46]
ELLAGIC ACID DMX8BS5 Discovery agent N.A. Investigative [6]
ETHYL 3-[4-(AMINOSULFONYL)PHENYL]PROPANOATE DMKJGLO Discovery agent N.A. Investigative [21]
GALLICACID DM6Y3A0 Discovery agent N.A. Investigative [6]
HERNIARIN DM9UASM Discovery agent N.A. Investigative [20]
Hexane-1,6-diamine DMSHF0K Discovery agent N.A. Investigative [47]
HYDROSULFIDE DMO32HN Discovery agent N.A. Investigative [40]
IODIDE DM3FZ6P Discovery agent N.A. Investigative [8]
L-693612 DMMUYHX Glaucoma/ocular hypertension 9C61 Investigative [48]
N-(4-cyanophenyl)sulfamide DMW8S2D Discovery agent N.A. Investigative [49]
N-(4-Sulfamoyl-phenyl)-benzamide DMZDACT Discovery agent N.A. Investigative [13]
N-(4-Sulfamoyl-phenyl)-butyramide DM3FW9Q Discovery agent N.A. Investigative [13]
N-(4-Sulfamoyl-phenyl)-propionamide DM7MHQD Discovery agent N.A. Investigative [13]
N-(4-sulfamoylphenylethyl)-4-sulfamoylbenzamide DM7QX03 Discovery agent N.A. Investigative [50]
N-(5-ethyl-1,3,4-thiadiazol-2-yl)sulfamide DMNQDLC Discovery agent N.A. Investigative [51]
N-(5-Mercapto-[1,3,4]thiadiazol-2-yl)-acetamide DMSQEXP Discovery agent N.A. Investigative [35]
N-(5-phenyl-1,3,4-thiadiazol-2-yl)sulfamide DMA21WB Discovery agent N.A. Investigative [51]
N-(5-tert-butyl-1,3,4-thiadiazol-2-yl)sulfamide DM5E7OC Discovery agent N.A. Investigative [51]
N-(pentafluorophenyl)sulfamide DME45J8 Discovery agent N.A. Investigative [49]
N-1,3,4-thiadiazol-2-ylsulfamide DMJ10WH Discovery agent N.A. Investigative [51]
N-hydroxysulfamide DMTDBMU Discovery agent N.A. Investigative [52]
N-hydroxysulfonamides DMJBC03 Discovery agent N.A. Investigative [53]
N-propynyl amidebenzenesulphonide DMWTPJH Discovery agent N.A. Investigative [54]
N-[4-(trifluoromethyl)phenyl]sulfamide DMMX65T Discovery agent N.A. Investigative [49]
N-[5-(ethylthio)-1,3,4-thiadiazol-2-yl]sulfamide DMSI4PE Discovery agent N.A. Investigative [51]
N-[5-(methylthio)-1,3,4-thiadiazol-2-yl]sulfamide DMXLJGR Discovery agent N.A. Investigative [51]
N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE DMX4QKU Discovery agent N.A. Investigative [21]
NITRATE DMVFB93 Discovery agent N.A. Investigative [8]
NSC-654077 DMW3QAK Discovery agent N.A. Investigative [18]
Octane-1,8-diyl disulfamate DMBQMGH Discovery agent N.A. Investigative [46]
Octyl sulfamate DM40ZCA Discovery agent N.A. Investigative [46]
P-Coumaric Acid DMGJSVD Discovery agent N.A. Investigative [6]
PARAOXON DMN4ZKC Discovery agent N.A. Investigative [34]
Pentane-1,5-diamine DMVPZG9 Discovery agent N.A. Investigative [47]
Pentanoic acid (4-sulfamoyl-phenyl)-amide DMAZ07T Discovery agent N.A. Investigative [13]
Phenethylboronic acid DMPDVG2 Discovery agent N.A. Investigative [17]
Phenoxyarsonous acid DMZJO5V Discovery agent N.A. Investigative [8]
Phenyl Boronic acid DMFZH49 Discovery agent N.A. Investigative [8]
PHENYLDIFLUOROMETHANESULFONAMIDE DME75VC Discovery agent N.A. Investigative [9]
PHENYLMETHANESULFONAMIDE DMGLDFI Discovery agent N.A. Investigative [9]
PHENYLSULFAMATE DMRLFJV Discovery agent N.A. Investigative [9]
Prop-2-ynyl 4-sulfamoylbenzoate DM8O41M Discovery agent N.A. Investigative [54]
SACCHARIN DMRA736 Discovery agent N.A. Investigative [29]
Sodium trithiocarbonate DM6WYGC Discovery agent N.A. Investigative [55]
Styrylboronic acid DMJ4Z7W Discovery agent N.A. Investigative [17]
SULFAMATE DMF1589 Discovery agent N.A. Investigative [8]
Sulfamic acid 12-sulfamoyloxy-dodecyl ester DM9XNSK Discovery agent N.A. Investigative [56]
Sulfamic acid 16-sulfamoyloxy-hexadecyl ester DM7VBSY Discovery agent N.A. Investigative [56]
Sulfamic acid 3-sulfamoyloxy-phenyl ester DMA0MEV Discovery agent N.A. Investigative [56]
Sulfamic acid 4-sulfamoyloxy-butyl ester DMQZGNJ Discovery agent N.A. Investigative [56]
Sulfamic acid 6-sulfamoyloxy-hexyl ester DMT3U2D Discovery agent N.A. Investigative [56]
Sulfamic acid 7-sulfamoyloxy-heptyl ester DMVWEN3 Discovery agent N.A. Investigative [56]
SULFATE DMW0ZBF Discovery agent N.A. Investigative [8]
Syringic Acid DM802V7 Discovery agent N.A. Investigative [6]
Thioureido sulfonamide DM8WYEM Discovery agent N.A. Investigative [57]
Trecadrine DMDX0VI Discovery agent N.A. Investigative [58]
[Au(CN)2]- DMN70VT Discovery agent N.A. Investigative [59]
[Cu(CN)2]- DMV6NP1 Discovery agent N.A. Investigative [59]
------------------------------------------------------------------------------------
⏷ Show the Full List of 178 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Breast cancer 2C82 Breast tissue 5.23E-14 -0.11 -0.41
Rheumatoid arthritis FA20 Synovial tissue 1.15E-01 -0.08 -0.33
------------------------------------------------------------------------------------

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2597).
2 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
3 Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem. 2008 Aug 1;16(15):7424-8.
4 Understanding the Dual Inhibition of COX-2 and Carbonic Anhydrase-II by Celecoxib and CG100649 Using Density Functional Theory Calculations and other Molecular Modelling Approaches. Protein Pept Lett. 2015;22(10):903-12.
5 Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3.
6 Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. Bioorg Med Chem. 2010 Mar 15;18(6):2159-2164.
7 Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-r... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6.
8 Carbonic anhydrase inhibitors. Inhibition of the newly isolated murine isozyme XIII with anions. Bioorg Med Chem Lett. 2004 Nov 1;14(21):5435-9.
9 Carbonic anhydrase inhibitors: inhibition of the human isozymes I, II, VA, and IX with a library of substituted difluoromethanesulfonamides. Bioorg Med Chem Lett. 2005 Dec 1;15(23):5192-6.
10 Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the... Eur J Med Chem. 2010 Sep;45(9):3656-61.
11 Carbonic anhydrase inhibitors. Design of anticonvulsant sulfonamides incorporating indane moieties. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5781-6.
12 Indanesulfonamides as carbonic anhydrase inhibitors. Toward structure-based design of selective inhibitors of the tumor-associated isozyme CA IX. J Med Chem. 2006 May 4;49(9):2743-9.
13 Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.
14 Synthesis, characterization and antiglaucoma activity of a novel proton transfer compound and a mixed-ligand Zn(II) complex. Bioorg Med Chem. 2010 Jan 15;18(2):930-8.
15 Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. Bioorg Med Chem. 2009 Jul 15;17(14):5054-8.
16 Carbonic anhydrase and matrix metalloproteinase inhibitors. Inhibition of human tumor-associated isozymes IX and cytosolic isozyme I and II with su... Bioorg Med Chem. 2007 Mar 15;15(6):2298-311.
17 Carbonic anhydrase inhibitors. Inhibition of the fungal beta-carbonic anhydrases from Candida albicans and Cryptococcus neoformans with boronic acids. Bioorg Med Chem Lett. 2009 May 15;19(10):2642-5.
18 Recent developments of carbonic anhydrase inhibitors as potential anticancer drugs. J Med Chem. 2008 Jun 12;51(11):3051-6.
19 Carbonic anhydrase inhibitors. Novel sulfanilamide/acetazolamide derivatives obtained by the tail approach and their interaction with the cytosolic... Bioorg Med Chem Lett. 2005 Jan 17;15(2):367-72.
20 Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem. 2010 Jan 14;53(1):335-44.
21 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
22 Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/membrane-associated carbonic anhydrase isozymes I, II, and IX with sulfonamide... J Med Chem. 2005 Mar 24;48(6):2121-5.
23 Carbonic anhydrase inhibitors: Hypoxia-activatable sulfonamides incorporating disulfide bonds that target the tumor-associated isoform IX. J Med Chem. 2006 Sep 7;49(18):5544-51.
24 Discovery of low nanomolar and subnanomolar inhibitors of the mycobacterial beta-carbonic anhydrases Rv1284 and Rv3273. J Med Chem. 2009 Jul 9;52(13):4063-7.
25 Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associa... Eur J Med Chem. 2010 Jun;45(6):2396-404.
26 In vitro inhibition of salicylic acid derivatives on human cytosolic carbonic anhydrase isozymes I and II. Bioorg Med Chem. 2008 Oct 15;16(20):9101-5.
27 Carbonic anhydrase inhibitors. Design of fluorescent sulfonamides as probes of tumor-associated carbonic anhydrase IX that inhibit isozyme IX-media... J Med Chem. 2005 Jul 28;48(15):4834-41.
28 Carbonic anhydrase inhibitors. Aromatic/heterocyclic sulfonamides incorporating phenacetyl, pyridylacetyl and thienylacetyl tails act as potent inh... Bioorg Med Chem. 2009 Jul 15;17(14):4894-9.
29 Mutation of Phe91 to Asn in human carbonic anhydrase I unexpectedly enhanced both catalytic activity and affinity for sulfonamide inhibitors. Bioorg Med Chem. 2010 Aug 1;18(15):5498-503.
30 Inhibition of human mitochondrial carbonic anhydrases VA and VB with para-(4-phenyltriazole-1-yl)-benzenesulfonamide derivatives. Bioorg Med Chem Lett. 2008 Aug 15;18(16):4624-7.
31 Inhibition of carbonic anhydrases with glycosyltriazole benzene sulfonamides. J Med Chem. 2008 Mar 27;51(6):1945-53.
32 Ligand-based and structure-based virtual screening to identify carbonic anhydrase IX inhibitors. Bioorg Med Chem. 2009 Jan 15;17(2):553-7.
33 Carbonic anhydrase inhibitors: the first on-resin screening of a 4-sulfamoylphenylthiourea library. J Med Chem. 2004 Oct 7;47(21):5224-9.
34 Paraoxon, 4-nitrophenyl phosphate and acetate are substrates of - but not of -, - and -carbonic anhydrases. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6208-12.
35 Carbonic anhydrase inhibitors. Inhibition of the cytosolic and tumor-associated carbonic anhydrase isozymes I, II, and IX with a series of 1,3,4-th... Bioorg Med Chem Lett. 2005 May 2;15(9):2347-52.
36 A novel and one-pot synthesis of new 1-tosyl pyrrol-2-one derivatives and analysis of carbonic anhydrase inhibitory potencies. Bioorg Med Chem. 2010 Jun 15;18(12):4468-74.
37 Carbonic anhydrase inhibitors. Synthesis of water-soluble, topically effective, intraocular pressure-lowering aromatic/heterocyclic sulfonamides co... J Med Chem. 1999 Jul 15;42(14):2641-50.
38 Cloning, expression, post-translational modifications and inhibition studies on the latest mammalian carbonic anhydrase isoform, CA XV. J Med Chem. 2009 Feb 12;52(3):646-54.
39 Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides d... Bioorg Med Chem Lett. 2004 Dec 6;14(23):5775-80.
40 Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5769-73.
41 Ligand-directed tosyl chemistry for protein labeling in vivo. Nat Chem Biol. 2009 May;5(5):341-3.
42 Carbonic anhydrase inhibitors. Inhibition of the human cytosolic isozyme VII with aromatic and heterocyclic sulfonamides. Bioorg Med Chem Lett. 2005 Feb 15;15(4):971-6.
43 Carbonic anhydrase inhibitors. Interaction of isozymes I, II, IV, V, and IX with phosphates, carbamoyl phosphate, and the phosphonate antiviral dru... Bioorg Med Chem Lett. 2004 Dec 6;14(23):5763-7.
44 7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and X... Bioorg Med Chem Lett. 2010 Dec 15;20(24):7255-8.
45 Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4563-7.
46 Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-bi... J Med Chem. 2009 Oct 8;52(19):5990-8.
47 Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem. 2010 Aug 12;53(15):5511-22.
48 Dose-dependent pharmacokinetics of L-693,612, a carbonic anhydrase inhibitor, following oral administration in rats. Pharm Res. 1994 Mar;11(3):438-41.
49 Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxy... Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8.
50 Pteridine-sulfonamide conjugates as dual inhibitors of carbonic anhydrases and dihydrofolate reductase with potential antitumor activity. Bioorg Med Chem. 2010 Jul 15;18(14):5081-9.
51 Carbonic anhydrase inhibitors: 2-substituted-1,3,4-thiadiazole-5-sulfamides act as powerful and selective inhibitors of the mitochondrial isozymes ... Bioorg Med Chem Lett. 2008 Dec 15;18(24):6332-5.
52 Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mamm... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5.
53 Carbonic anhydrase inhibitors: inhibition of isozymes I, II and IV with N-hydroxysulfonamides--a novel class of intraocular pressure lowering agents. J Enzyme Inhib. 1998 Jul;13(4):267-84.
54 A novel class of carbonic anhydrase inhibitors: glycoconjugate benzene sulfonamides prepared by "click-tailing". J Med Chem. 2006 Nov 2;49(22):6539-48.
55 Carbonic anhydrase inhibitors. Inhibition of cytosolic isoforms I, II, III, VII and XIII with less investigated inorganic anions. Bioorg Med Chem Lett. 2009 Apr 1;19(7):1855-7.
56 Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with bis-sulfamates. Bioorg Med Chem Lett. 2005 Feb 1;15(3):579-84.
57 Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowe... Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.
58 Sulfenamido-sulfonamides as inhibitors of carbonic anhydrase isozymes I, II and IV. J Enzyme Inhib. 1997 Aug;12(3):175-90.
59 Carbonic anhydrase inhibitors. Inhibition of isozymes I, II, IV, V and IX with complex fluorides, chlorides and cyanides. Bioorg Med Chem Lett. 2005 Apr 1;15(7):1909-13.