Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9YTYMB)

• DOT Name: Fos-related antigen 1 (FOSL1)
• Synonyms: FRA-1
• Gene Name: FOSL1
• UniProt ID: FOSL1_HUMAN
• Pfam ID: PF00170
• Sequence:
  MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG
  PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
  KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE
  GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
  PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
• KEGG Pathway:
  Wnt sig.ling pathway (hsa04310)
  Osteoclast differentiation (hsa04380)
  IL-17 sig.ling pathway (hsa04657)
  Human T-cell leukemia virus 1 infection (hsa05166)
• Reactome Pathway: NGF-stimulated transcription (R-HSA-9031628)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Fos-related antigen 1 (FOSL1) affects the response to substance of Doxorubicin.	[51]
Vinblastine	DM5TVS3	Approved	Fos-related antigen 1 (FOSL1) affects the response to substance of Vinblastine.	[51]

54 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Fos-related antigen 1 (FOSL1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Fos-related antigen 1 (FOSL1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Fos-related antigen 1 (FOSL1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Fos-related antigen 1 (FOSL1).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Fos-related antigen 1 (FOSL1).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Fos-related antigen 1 (FOSL1).	[1]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Fos-related antigen 1 (FOSL1).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Fos-related antigen 1 (FOSL1).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Fos-related antigen 1 (FOSL1).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Fos-related antigen 1 (FOSL1).	[9]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Fos-related antigen 1 (FOSL1).	[10]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Fos-related antigen 1 (FOSL1).	[11]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Fos-related antigen 1 (FOSL1).	[12]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Fos-related antigen 1 (FOSL1).	[13]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Fos-related antigen 1 (FOSL1).	[14]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Fos-related antigen 1 (FOSL1).	[15]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Fos-related antigen 1 (FOSL1).	[16]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Fos-related antigen 1 (FOSL1).	[17]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Fos-related antigen 1 (FOSL1).	[18]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Fos-related antigen 1 (FOSL1).	[19]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Fos-related antigen 1 (FOSL1).	[16]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Fos-related antigen 1 (FOSL1).	[20]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Fos-related antigen 1 (FOSL1).	[16]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Fos-related antigen 1 (FOSL1).	[16]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of Fos-related antigen 1 (FOSL1).	[21]
Atazanavir	DMSYRBX	Approved	Atazanavir increases the expression of Fos-related antigen 1 (FOSL1).	[21]
Amphetamine	DMSZQAK	Approved	Amphetamine increases the expression of Fos-related antigen 1 (FOSL1).	[22]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Fos-related antigen 1 (FOSL1).	[23]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Fos-related antigen 1 (FOSL1).	[24]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine increases the expression of Fos-related antigen 1 (FOSL1).	[26]
Phenol	DM1QSM3	Phase 2/3	Phenol increases the expression of Fos-related antigen 1 (FOSL1).	[27]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Fos-related antigen 1 (FOSL1).	[28]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Fos-related antigen 1 (FOSL1).	[25]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Fos-related antigen 1 (FOSL1).	[29]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Fos-related antigen 1 (FOSL1).	[31]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Fos-related antigen 1 (FOSL1).	[32]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of Fos-related antigen 1 (FOSL1).	[33]
IRX4204	DM9SCME	Phase 1	IRX4204 decreases the expression of Fos-related antigen 1 (FOSL1).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Fos-related antigen 1 (FOSL1).	[36]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Fos-related antigen 1 (FOSL1).	[37]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Fos-related antigen 1 (FOSL1).	[39]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Fos-related antigen 1 (FOSL1).	[40]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Fos-related antigen 1 (FOSL1).	[27]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of Fos-related antigen 1 (FOSL1).	[41]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Fos-related antigen 1 (FOSL1).	[42]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Fos-related antigen 1 (FOSL1).	[43]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Fos-related antigen 1 (FOSL1).	[44]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Fos-related antigen 1 (FOSL1).	[45]
Bilirubin	DMI0V4O	Investigative	Bilirubin increases the expression of Fos-related antigen 1 (FOSL1).	[46]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Fos-related antigen 1 (FOSL1).	[47]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid increases the expression of Fos-related antigen 1 (FOSL1).	[48]
Protoporphyrin IX	DMWYE7A	Investigative	Protoporphyrin IX decreases the expression of Fos-related antigen 1 (FOSL1).	[49]
Silmitasertib	DMQIBZD	Investigative	Silmitasertib increases the expression of Fos-related antigen 1 (FOSL1).	[29]
NEUROTENSIN	DM27WCE	Investigative	NEUROTENSIN increases the activity of Fos-related antigen 1 (FOSL1).	[50]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Curcumin	DMQPH29	Phase 3	Curcumin increases the ubiquitination of Fos-related antigen 1 (FOSL1).	[25]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Fos-related antigen 1 (FOSL1).	[30]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Fos-related antigen 1 (FOSL1).	[35]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the methylation of Fos-related antigen 1 (FOSL1).	[38]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Altered ErbB receptor signaling and gene expression in cisplatin-resistant ovarian cancer. Cancer Res. 2005 Aug 1;65(15):6789-800. doi: 10.1158/0008-5472.CAN-04-2684.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] A comprehensive analysis of Wnt/beta-catenin signaling pathway-related genes and crosstalk pathways in the treatment of As2O3 in renal cancer. Ren Fail. 2018 Nov;40(1):331-339.
• [9] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [10] Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.
• [11] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [12] New insights into the mechanisms underlying 5-fluorouracil-induced intestinal toxicity based on transcriptomic and metabolomic responses in human intestinal organoids. Arch Toxicol. 2021 Aug;95(8):2691-2718. doi: 10.1007/s00204-021-03092-2. Epub 2021 Jun 20.
• [13] Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
• [14] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [15] Analysis of gene expression induced by diethylstilbestrol (DES) in human primitive Mullerian duct cells using microarray. Cancer Lett. 2005 Apr 8;220(2):197-210.
• [16] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [17] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [18] Antitumor effect of aspirin in glioblastoma cells by modulation of -catenin/T-cell factor-mediated transcriptional activity. J Neurosurg. 2011 Oct;115(4):780-8. doi: 10.3171/2011.5.JNS113. Epub 2011 Jul 1.
• [19] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [20] Transcriptional profiling in the human prefrontal cortex: evidence for two activational states associated with cocaine abuse. Pharmacogenomics J. 2003;3(1):27-40.
• [21] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [22] Effect of acute and chronic psychostimulant drugs on redox status, AP-1 activation and pro-enkephalin mRNA in the human astrocyte-like U373 MG cells. Neuropharmacology. 2005 Apr;48(5):673-84. doi: 10.1016/j.neuropharm.2004.12.010.
• [23] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [24] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [25] Curcumin suppresses AP1 transcription factor-dependent differentiation and activates apoptosis in human epidermal keratinocytes. J Biol Chem. 2007 Mar 2;282(9):6707-15. doi: 10.1074/jbc.M606003200. Epub 2006 Dec 5.
• [26] Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
• [27] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [28] Human relevance of an in vitro gene signature in HaCaT for skin sensitization. Toxicol In Vitro. 2015 Feb;29(1):81-4. doi: 10.1016/j.tiv.2014.08.010. Epub 2014 Sep 16.
• [29] MEK inhibitor PD-0325901 overcomes resistance to CK2 inhibitor CX-4945 and exhibits anti-tumor activity in head and neck cancer. Int J Biol Sci. 2015 Feb 23;11(4):411-22. doi: 10.7150/ijbs.10745. eCollection 2015.
• [30] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [31] Sensitivity of human lung adenocarcinoma cell lines to targeted inhibition of BET epigenetic signaling proteins. Proc Natl Acad Sci U S A. 2012 Nov 20;109(47):19408-13. doi: 10.1073/pnas.1216363109. Epub 2012 Nov 5.
• [32] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [33] A novel combination: ranpirnase and rosiglitazone induce a synergistic apoptotic effect by down-regulating Fra-1 and Survivin in cancer cells. Mol Cancer Ther. 2008 Jul;7(7):1871-9. doi: 10.1158/1535-7163.MCT-08-0308. Epub 2008 Jul 7.
• [34] A retinoid X receptor (RXR)-selective retinoid reveals that RXR-alpha is potentially a therapeutic target in breast cancer cell lines, and that it potentiates antiproliferative and apoptotic responses to peroxisome proliferator-activated receptor ligands. Breast Cancer Res. 2004;6(5):R546-55. doi: 10.1186/bcr913. Epub 2004 Jul 23.
• [35] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [36] Low dose of bisphenol a modulates ovarian cancer gene expression profile and promotes epithelial to mesenchymal transition via canonical Wnt pathway. Toxicol Sci. 2018 Aug 1;164(2):527-538.
• [37] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [38] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [39] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [40] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [41] High ambient glucose augments angiotensin II-induced proinflammatory gene mRNA expression in human mesangial cells: effects of valsartan and simvastatin. Am J Nephrol. 2009;30(2):99-111.
• [42] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [43] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [44] Okadaic acid activates Wnt/-catenin-signaling in human HepaRG cells. Arch Toxicol. 2019 Jul;93(7):1927-1939. doi: 10.1007/s00204-019-02489-4. Epub 2019 May 21.
• [45] The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
• [46] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [47] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [48] Induction of fibroblast growth factor-9 and interleukin-1alpha gene expression by motorcycle exhaust particulate extracts and benzo(a)pyrene in human lung adenocarcinoma cells. Toxicol Sci. 2005 Oct;87(2):483-96. doi: 10.1093/toxsci/kfi251. Epub 2005 Jul 7.
• [49] Arsenite suppression of involucrin transcription through AP1 promoter sites in cultured human keratinocytes. Toxicol Appl Pharmacol. 2010 Mar 15;243(3):275-82. doi: 10.1016/j.taap.2009.12.006. Epub 2009 Dec 16.
• [50] Curcumin inhibits neurotensin-mediated interleukin-8 production and migration of HCT116 human colon cancer cells. Clin Cancer Res. 2006 Sep 15;12(18):5346-55. doi: 10.1158/1078-0432.CCR-06-0968.
• [51] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.