Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI4I2V1)

• DOT Name: Interstitial collagenase (MMP1)
• Synonyms: EC 3.4.24.7; Fibroblast collagenase; Matrix metalloproteinase-1; MMP-1
• Gene Name: MMP1
• UniProt ID: MMP1_HUMAN
• PDB ID: 1AYK; 1CGE; 1CGF; 1CGL; 1HFC; 1SU3; 2AYK; 2CLT; 2J0T; 2TCL; 3AYK; 3SHI; 4AUO; 4AYK; 966C
• EC Number: 3.4.24.7
• Pfam ID: PF00045 ; PF00413 ; PF01471
• Sequence:
  MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
  VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
  YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
  LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
  TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
  FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
  PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
  GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
• Function: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
• KEGG Pathway:
  PPAR sig.ling pathway (hsa03320)
  IL-17 sig.ling pathway (hsa04657)
  Relaxin sig.ling pathway (hsa04926)
  Coro.virus disease - COVID-19 (hsa05171)
  Pathways in cancer (hsa05200)
  Bladder cancer (hsa05219)
  Rheumatoid arthritis (hsa05323)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  Degradation of the extracellular matrix (R-HSA-1474228)
  Activation of Matrix Metalloproteinases (R-HSA-1592389)
  Basigin interactions (R-HSA-210991)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Collagen degradation (R-HSA-1442490)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Interstitial collagenase (MMP1) affects the response to substance of Paclitaxel.	[72]
Topotecan	DMP6G8T	Approved	Interstitial collagenase (MMP1) affects the response to substance of Topotecan.	[72]
Vinblastine	DM5TVS3	Approved	Interstitial collagenase (MMP1) affects the response to substance of Vinblastine.	[72]

77 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Interstitial collagenase (MMP1).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Interstitial collagenase (MMP1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interstitial collagenase (MMP1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Interstitial collagenase (MMP1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Interstitial collagenase (MMP1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Interstitial collagenase (MMP1).	[7]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Interstitial collagenase (MMP1).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Interstitial collagenase (MMP1).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Interstitial collagenase (MMP1).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Interstitial collagenase (MMP1).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Interstitial collagenase (MMP1).	[12]
Triclosan	DMZUR4N	Approved	Triclosan affects the expression of Interstitial collagenase (MMP1).	[13]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Interstitial collagenase (MMP1).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Interstitial collagenase (MMP1).	[15]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Interstitial collagenase (MMP1).	[16]
Marinol	DM70IK5	Approved	Marinol increases the expression of Interstitial collagenase (MMP1).	[17]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Interstitial collagenase (MMP1).	[18]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Interstitial collagenase (MMP1).	[19]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Interstitial collagenase (MMP1).	[20]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Interstitial collagenase (MMP1).	[21]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Interstitial collagenase (MMP1).	[22]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Interstitial collagenase (MMP1).	[23]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Interstitial collagenase (MMP1).	[24]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Interstitial collagenase (MMP1).	[25]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Interstitial collagenase (MMP1).	[26]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Interstitial collagenase (MMP1).	[27]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Interstitial collagenase (MMP1).	[29]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Interstitial collagenase (MMP1).	[30]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Interstitial collagenase (MMP1).	[31]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Interstitial collagenase (MMP1).	[32]
Phenytoin	DMNOKBV	Approved	Phenytoin decreases the expression of Interstitial collagenase (MMP1).	[33]
Rofecoxib	DM3P5DA	Approved	Rofecoxib increases the expression of Interstitial collagenase (MMP1).	[31]
Bexarotene	DMOBIKY	Approved	Bexarotene decreases the expression of Interstitial collagenase (MMP1).	[34]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of Interstitial collagenase (MMP1).	[35]
Ardeparin	DMYRX8B	Approved	Ardeparin decreases the activity of Interstitial collagenase (MMP1).	[36]
Bleomycin	DMNER5S	Approved	Bleomycin increases the expression of Interstitial collagenase (MMP1).	[37]
Tofacitinib	DMBS370	Approved	Tofacitinib decreases the expression of Interstitial collagenase (MMP1).	[38]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR increases the expression of Interstitial collagenase (MMP1).	[39]
Ergotidine	DM78IME	Approved	Ergotidine increases the expression of Interstitial collagenase (MMP1).	[40]
Lamivudine	DMI347A	Approved	Lamivudine increases the expression of Interstitial collagenase (MMP1).	[41]
Aminolevulinic acid hci	DMS4BLQ	Approved	Aminolevulinic acid hci affects the expression of Interstitial collagenase (MMP1).	[42]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Interstitial collagenase (MMP1).	[12]
Benzylpenicillin	DMS9503	Phase 3	Benzylpenicillin decreases the expression of Interstitial collagenase (MMP1).	[44]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Interstitial collagenase (MMP1).	[45]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Interstitial collagenase (MMP1).	[46]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Interstitial collagenase (MMP1).	[47]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Interstitial collagenase (MMP1).	[48]
SEN-196	DMLDBQ5	Phase 2	SEN-196 increases the expression of Interstitial collagenase (MMP1).	[49]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Interstitial collagenase (MMP1).	[50]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Interstitial collagenase (MMP1).	[51]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Interstitial collagenase (MMP1).	[52]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the expression of Interstitial collagenase (MMP1).	[53]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin decreases the expression of Interstitial collagenase (MMP1).	[54]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Interstitial collagenase (MMP1).	[55]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Interstitial collagenase (MMP1).	[56]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Interstitial collagenase (MMP1).	[57]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Interstitial collagenase (MMP1).	[58]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Interstitial collagenase (MMP1).	[59]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Interstitial collagenase (MMP1).	[60]
Paraquat	DMR8O3X	Investigative	Paraquat affects the expression of Interstitial collagenase (MMP1).	[13]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Interstitial collagenase (MMP1).	[61]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal increases the expression of Interstitial collagenase (MMP1).	[62]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Interstitial collagenase (MMP1).	[63]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of Interstitial collagenase (MMP1).	[64]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Interstitial collagenase (MMP1).	[65]
acrolein	DMAMCSR	Investigative	acrolein increases the expression of Interstitial collagenase (MMP1).	[64]
Chrysin	DM7V2LG	Investigative	Chrysin decreases the expression of Interstitial collagenase (MMP1).	[66]
Apigenin	DMI3491	Investigative	Apigenin decreases the expression of Interstitial collagenase (MMP1).	[53]
PD98059	DMZC90M	Investigative	PD98059 decreases the expression of Interstitial collagenase (MMP1).	[9]
15-deoxy-Delta(12, 14)-prostaglandin J(2)	DM8VUX3	Investigative	15-deoxy-Delta(12, 14)-prostaglandin J(2) increases the expression of Interstitial collagenase (MMP1).	[67]
Protoporphyrin IX	DMWYE7A	Investigative	Protoporphyrin IX increases the expression of Interstitial collagenase (MMP1).	[67]
DIECKOL	DMBCK4G	Investigative	DIECKOL decreases the expression of Interstitial collagenase (MMP1).	[68]
Anandamide	DMCKH3P	Investigative	Anandamide increases the expression of Interstitial collagenase (MMP1).	[17]
CI-1040	DMF3DZX	Investigative	CI-1040 decreases the expression of Interstitial collagenase (MMP1).	[64]
Selumetinib	DMC7W6R	Investigative	Selumetinib decreases the activity of Interstitial collagenase (MMP1).	[69]
RGD	DMFASRB	Investigative	RGD increases the expression of Interstitial collagenase (MMP1).	[70]
CAPSAZEPINE	DM4ATCI	Investigative	CAPSAZEPINE affects the expression of Interstitial collagenase (MMP1).	[71]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the degradation of Interstitial collagenase (MMP1).	[2]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the secretion of Interstitial collagenase (MMP1).	[28]
Zithromax	DMN4H2O	Approved	Zithromax decreases the secretion of Interstitial collagenase (MMP1).	[43]

References

• [1] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [2] Interaction between the aryl hydrocarbon receptor and retinoic acid pathways increases matrix metalloproteinase-1 expression in keratinocytes. J Biol Chem. 2004 Jun 11;279(24):25284-93. doi: 10.1074/jbc.M402168200. Epub 2004 Apr 9.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Cisplatin triggers oxidative stress, apoptosis and pro-inflammatory responses by inhibiting the SIRT1-mediated Nrf2 pathway in chondrocytes. Environ Toxicol. 2023 Oct;38(10):2476-2486. doi: 10.1002/tox.23885. Epub 2023 Jul 27.
• [7] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [8] Gene expression of inflammatory molecules in circulating lymphocytes from arsenic-exposed human subjects. Environ Health Perspect. 2003 Aug;111(11):1429-38. doi: 10.1289/ehp.6396.
• [9] Quercetin inhibits matrix metalloproteinase-1 expression in human vascular endothelial cells through extracellular signal-regulated kinase. Arch Biochem Biophys. 2001 Jul 1;391(1):72-8. doi: 10.1006/abbi.2001.2402.
• [10] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [11] Oxidative Stress-Protective and Anti-Melanogenic Effects of Loliolide and Ethanol Extract from Fresh Water Green Algae, Prasiola japonica. Int J Mol Sci. 2018 Sep 18;19(9):2825. doi: 10.3390/ijms19092825.
• [12] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [13] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [14] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [15] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [16] Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
• [17] R(+)-methanandamide and other cannabinoids induce the expression of cyclooxygenase-2 and matrix metalloproteinases in human nonpigmented ciliary epithelial cells. J Pharmacol Exp Ther. 2006 Mar;316(3):1219-28.
• [18] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [19] Topical fluorouracil for actinic keratoses and photoaging: a clinical and molecular analysis. Arch Dermatol. 2009 Jun;145(6):659-66. doi: 10.1001/archdermatol.2009.97.
• [20] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [21] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [22] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [23] Basal and UV-induced MMP-1 expression are inhibited by p53 in human dermal fibroblasts. Exp Dermatol. 2008 Nov;17(11):939-45. doi: 10.1111/j.1600-0625.2008.00729.x. Epub 2008 Jun 14.
• [24] Nicotine treatment induces expression of matrix metalloproteinases in human osteoblastic Saos-2 cells. Acta Biochim Biophys Sin (Shanghai). 2006 Dec;38(12):874-82. doi: 10.1111/j.1745-7270.2006.00240.x.
• [25] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [26] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [27] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [28] Simvastatin reduces MMP1 expression in human smooth muscle cells cultured on polymerized collagen by inhibiting Rac1 activation. Arterioscler Thromb Vasc Biol. 2007 May;27(5):1043-9. doi: 10.1161/ATVBAHA.107.139881. Epub 2007 Feb 15.
• [29] AMPK-dependent signaling modulates the suppression of invasion and migration by fenofibrate in CAL 27 oral cancer cells through NF-B pathway. Environ Toxicol. 2016 Jul;31(7):866-76. doi: 10.1002/tox.22097. Epub 2014 Dec 24.
• [30] Capsaicin promotes a more aggressive gene expression phenotype and invasiveness in null-TRPV1 urothelial cancer cells. Carcinogenesis. 2011 May;32(5):686-94. doi: 10.1093/carcin/bgr025. Epub 2011 Feb 10.
• [31] Rofecoxib regulates the expression of genes related to the matrix metalloproteinase pathway in humans: implication for the adverse effects of cyclooxygenase-2 inhibitors. Clin Pharmacol Ther. 2006 Apr;79(4):303-15. doi: 10.1016/j.clpt.2005.12.306.
• [32] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [33] Impaired degradation of matrix collagen in human gingival fibroblasts by the antiepileptic drug phenytoin. J Periodontol. 2005 Jun;76(6):941-50. doi: 10.1902/jop.2005.76.6.941.
• [34] Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
• [35] The effects of a novel synthetic retinoid, seletinoid G, on the expression of extracellular matrix proteins in aged human skin in vivo. Clin Chim Acta. 2005 Dec;362(1-2):161-9. doi: 10.1016/j.cccn.2005.06.016. Epub 2005 Aug 1.
• [36] Effect of heparin and related glycosaminoglycan on PDGF-induced lung fibroblast proliferation, chemotactic response and matrix metalloproteinases activity. Mediators Inflamm. 2000;9(2):85-91. doi: 10.1080/096293500411541.
• [37] Agents associated with lung inflammation induce similar responses in NCI-H292 lung epithelial cells. Toxicol In Vitro. 2008 Oct;22(7):1782-8.
• [38] The JAK inhibitor tofacitinib suppresses synovial JAK1-STAT signalling in rheumatoid arthritis. Ann Rheum Dis. 2015 Jun;74(6):1311-6. doi: 10.1136/annrheumdis-2014-206028. Epub 2014 Nov 14.
• [39] Ciprofloxacin enhances the stimulation of matrix metalloproteinase 3 expression by interleukin-1beta in human tendon-derived cells. A potential mechanism of fluoroquinolone-induced tendinopathy. Arthritis Rheum. 2002 Nov;46(11):3034-40. doi: 10.1002/art.10617.
• [40] Histamine stimulation of MMP-1(collagenase-1) secretion and gene expression in gastric epithelial cells: role of EGFR transactivation and the MAP kinase pathway. Int J Biochem Cell Biol. 2007;39(11):2143-52. doi: 10.1016/j.biocel.2007.06.003. Epub 2007 Jun 24.
• [41] Effect of lamivudine treatment on plasma levels of transforming growth factor beta1, tissue inhibitor of metalloproteinases-1 and metalloproteinase-1 in patients with chronic hepatitis B. World J Gastroenterol. 2004 Sep 15;10(18):2661-5. doi: 10.3748/wjg.v10.i18.2661.
• [42] Influence of 5-aminolevulinic acid and red light on collagen metabolism of human dermal fibroblasts. J Invest Dermatol. 2003 Feb;120(2):325-31. doi: 10.1046/j.1523-1747.2003.12037.x.
• [43] Antimycobacterial drugs modulate immunopathogenic matrix metalloproteinases in a cellular model of pulmonary tuberculosis. Antimicrob Agents Chemother. 2014 Aug;58(8):4657-65. doi: 10.1128/AAC.02141-13. Epub 2014 Jun 2.
• [44] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [45] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [46] Upregulation of genes orchestrating keratinocyte differentiation, including the novel marker gene ID2, by contact sensitizers in human bulge-derived keratinocytes. J Biochem Mol Toxicol. 2010 Jan-Feb;24(1):10-20.
• [47] Retinoids interfere with the AP1 signalling pathway in human breast cancer cells. Cell Signal. 2006 Jun;18(6):889-98. doi: 10.1016/j.cellsig.2005.08.001. Epub 2005 Sep 19.
• [48] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [49] SIRT1 modulates expression of matrix metalloproteinases in human dermal fibroblasts. Br J Dermatol. 2010 Oct;163(4):689-94. doi: 10.1111/j.1365-2133.2010.09825.x.
• [50] Transcriptional signatures of environmentally relevant exposures in normal human mammary epithelial cells: benzo[a]pyrene. Cancer Lett. 2005 Apr 28;221(2):201-11.
• [51] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [52] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [53] The flavonoids apigenin and luteolin suppress ultraviolet A-induced matrix metalloproteinase-1 expression via MAPKs and AP-1-dependent signaling in HaCaT cells. J Dermatol Sci. 2011 Jan;61(1):23-31. doi: 10.1016/j.jdermsci.2010.10.016. Epub 2010 Nov 9.
• [54] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [55] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [56] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [57] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [58] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [59] Acetaldehyde regulates the gene expression of matrix-metalloproteinase-1 and -2 in human fat-storing cells. Life Sci. 1994;55(17):1311-6. doi: 10.1016/0024-3205(94)00763-2.
• [60] Deguelin inhibits the migration and invasion of U-2 OS human osteosarcoma cells via the inhibition of matrix metalloproteinase-2/-9 in vitro. Molecules. 2014 Oct 15;19(10):16588-608.
• [61] Non-nutritional sweeteners effects on endothelial vascular function. Toxicol In Vitro. 2020 Feb;62:104694. doi: 10.1016/j.tiv.2019.104694. Epub 2019 Oct 23.
• [62] 4-Hydroxynonenal as a selective pro-fibrogenic stimulus for activated human hepatic stellate cells. J Hepatol. 2004 Jan;40(1):60-8. doi: 10.1016/s0168-8278(03)00480-x.
• [63] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [64] Cigarette smoke components induce matrix metalloproteinase-1 in aortic endothelial cells through inhibition of mTOR signaling. Toxicol Sci. 2011 Oct;123(2):542-9. doi: 10.1093/toxsci/kfr181. Epub 2011 Jul 8.
• [65] The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
• [66] Chrysin inhibit human melanoma A375.S2 cell migration and invasion via affecting MAPK signaling and NF-B signaling pathway in vitro. Environ Toxicol. 2019 Apr;34(4):434-442. doi: 10.1002/tox.22697. Epub 2018 Dec 22.
• [67] 15-Deoxy-Delta12,14-prostaglandin J2 upregulates the expression of heme oxygenase-1 and subsequently matrix metalloproteinase-1 in human breast cancer cells: possible roles of iron and ROS. Carcinogenesis. 2009 Apr;30(4):645-54. doi: 10.1093/carcin/bgp012. Epub 2009 Jan 9.
• [68] Differentiation of human osteosarcoma cells by isolated phlorotannins is subtly linked to COX-2, iNOS, MMPs, and MAPK signaling: implication for chronic articular disease. Chem Biol Interact. 2009 May 15;179(2-3):192-201.
• [69] Ursonic acid exerts inhibitory effects on matrix metalloproteinases via ERK signaling pathway. Chem Biol Interact. 2020 Jan 5;315:108910. doi: 10.1016/j.cbi.2019.108910. Epub 2019 Nov 29.
• [70] Arg-Gly-Asp (RGD) peptide ameliorates carbon tetrachloride-induced liver fibrosis via inhibition of collagen production and acceleration of collagenase activity. Int J Mol Med. 2004 Dec;14(6):1049-53.
• [71] Transient receptor potential vanilloid-1 mediates heat-shock-induced matrix metalloproteinase-1 expression in human epidermal keratinocytes. J Invest Dermatol. 2007 Oct;127(10):2328-35. doi: 10.1038/sj.jid.5700880. Epub 2007 May 17.
• [72] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.