Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUCKOTT)

• DOT Name: Creatine kinase B-type (CKB)
• Synonyms: EC 2.7.3.2; Brain creatine kinase; B-CK; Creatine kinase B chain; Creatine phosphokinase B-type; CPK-B
• Gene Name: CKB
• Related Disease:
  Adenocarcinoma
  Advanced cancer
  Alzheimer disease
  Breast cancer
  Breast carcinoma
  Colon cancer
  Colon carcinoma
  Cytomegalovirus infection
  Deafness
  Epithelial ovarian cancer
  Hematologic disease
  Hereditary diffuse gastric adenocarcinoma
  Huntington disease
  leukaemia
  Leukemia
  Myocardial infarction
  Ovarian cancer
  Ovarian neoplasm
  Pick disease
  Stomach cancer
  Uveitis
  Vibrio cholerae infection
  Neoplasm
  Schizophrenia
  Non-insulin dependent diabetes
  Acute coronary syndrome
  Cervical cancer
  Cervical carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Exanthem
  Gastric cancer
  Gastric neoplasm
  Hepatitis C virus infection
  Hypoglycemia
  Osteopetrosis
  Polyp
  Precancerous condition
• UniProt ID: KCRB_HUMAN
• PDB ID: 3B6R; 3DRB; 3DRE; 6V9H; 7BF1; 7TUN
• EC Number: 2.7.3.2
• Pfam ID: PF00217 ; PF02807
• Sequence:
  MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
  VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
  LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
  EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
  QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
  NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
  IEMEQRLEQGQAIDDLMPAQK
• Function: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa (Probable). Acts as a key regulator of adaptive thermogenesis as part of the futile creatine cycle: localizes to the mitochondria of thermogenic fat cells and acts by mediating phosphorylation of creatine to initiate a futile cycle of creatine phosphorylation and dephosphorylation. During the futile creatine cycle, creatine and N-phosphocreatine are in a futile cycle, which dissipates the high energy charge of N-phosphocreatine as heat without performing any mechanical or chemical work.
• KEGG Pathway:
  Arginine and proline metabolism (hsa00330)
  Metabolic pathways (hsa01100)
• Reactome Pathway:
  RND3 GTPase cycle (R-HSA-9696264)
  Creatine metabolism (R-HSA-71288)
• BioCyc Pathway: MetaCyc:HS09344-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

38 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Colon cancer	DISVC52G	Strong	Altered Expression	[5]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[5]
Cytomegalovirus infection	DISCEMGC	Strong	Biomarker	[6]
Deafness	DISKCLH4	Strong	Biomarker	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[2]
Hematologic disease	DIS9XD9A	Strong	Altered Expression	[8]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Biomarker	[1]
Huntington disease	DISQPLA4	Strong	Altered Expression	[9]
leukaemia	DISS7D1V	Strong	Altered Expression	[8]
Leukemia	DISNAKFL	Strong	Altered Expression	[8]
Myocardial infarction	DIS655KI	Strong	Biomarker	[10]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[2]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[2]
Pick disease	DISP6X50	Strong	Altered Expression	[11]
Stomach cancer	DISKIJSX	Strong	Posttranslational Modification	[12]
Uveitis	DISV0RYS	Strong	Biomarker	[13]
Vibrio cholerae infection	DISW7E3U	Strong	Altered Expression	[14]
Neoplasm	DISZKGEW	moderate	Altered Expression	[15]
Schizophrenia	DISSRV2N	moderate	Biomarker	[16]
Non-insulin dependent diabetes	DISK1O5Z	Disputed	Genetic Variation	[17]
Acute coronary syndrome	DIS7DYEW	Limited	Biomarker	[18]
Cervical cancer	DISFSHPF	Limited	Biomarker	[19]
Cervical carcinoma	DIST4S00	Limited	Biomarker	[19]
Colonic neoplasm	DISSZ04P	Limited	Altered Expression	[20]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[20]
Exanthem	DISAFOQN	Limited	Biomarker	[20]
Gastric cancer	DISXGOUK	Limited	Posttranslational Modification	[12]
Gastric neoplasm	DISOKN4Y	Limited	Altered Expression	[12]
Hepatitis C virus infection	DISQ0M8R	Limited	Altered Expression	[21]
Hypoglycemia	DISRCKR7	Limited	Biomarker	[2]
Osteopetrosis	DIS7GHNM	Limited	Biomarker	[22]
Polyp	DISRSLYF	Limited	Altered Expression	[20]
Precancerous condition	DISV06FL	Limited	Altered Expression	[20]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Creatine kinase B-type (CKB) affects the response to substance of Fluorouracil.	[60]
Afimoxifene	DMFORDT	Phase 2	Creatine kinase B-type (CKB) decreases the response to substance of Afimoxifene.	[61]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Creatine kinase B-type (CKB).	[23]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Creatine kinase B-type (CKB).	[48]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Creatine kinase B-type (CKB).	[50]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Creatine kinase B-type (CKB).	[52]

43 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Creatine kinase B-type (CKB).	[24]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Creatine kinase B-type (CKB).	[25]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Creatine kinase B-type (CKB).	[26]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Creatine kinase B-type (CKB).	[27]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Creatine kinase B-type (CKB).	[28]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Creatine kinase B-type (CKB).	[29]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Creatine kinase B-type (CKB).	[30]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Creatine kinase B-type (CKB).	[31]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Creatine kinase B-type (CKB).	[32]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Creatine kinase B-type (CKB).	[33]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Creatine kinase B-type (CKB).	[34]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Creatine kinase B-type (CKB).	[35]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Creatine kinase B-type (CKB).	[36]
Marinol	DM70IK5	Approved	Marinol increases the expression of Creatine kinase B-type (CKB).	[37]
Selenium	DM25CGV	Approved	Selenium increases the expression of Creatine kinase B-type (CKB).	[38]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Creatine kinase B-type (CKB).	[39]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Creatine kinase B-type (CKB).	[34]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Creatine kinase B-type (CKB).	[29]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Creatine kinase B-type (CKB).	[25]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Creatine kinase B-type (CKB).	[40]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Creatine kinase B-type (CKB).	[41]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Creatine kinase B-type (CKB).	[42]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of Creatine kinase B-type (CKB).	[43]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Creatine kinase B-type (CKB).	[44]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of Creatine kinase B-type (CKB).	[31]
Tramadol	DMRQD04	Approved	Tramadol decreases the expression of Creatine kinase B-type (CKB).	[45]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the activity of Creatine kinase B-type (CKB).	[46]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Creatine kinase B-type (CKB).	[47]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Creatine kinase B-type (CKB).	[38]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Creatine kinase B-type (CKB).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Creatine kinase B-type (CKB).	[51]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Creatine kinase B-type (CKB).	[53]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Creatine kinase B-type (CKB).	[47]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Creatine kinase B-type (CKB).	[54]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Creatine kinase B-type (CKB).	[55]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Creatine kinase B-type (CKB).	[56]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Creatine kinase B-type (CKB).	[57]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Creatine kinase B-type (CKB).	[58]
D-glucose	DMMG2TO	Investigative	D-glucose increases the activity of Creatine kinase B-type (CKB).	[46]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Creatine kinase B-type (CKB).	[59]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Creatine kinase B-type (CKB).	[25]
Daidzein	DMRFTJX	Investigative	Daidzein increases the activity of Creatine kinase B-type (CKB).	[46]
biochanin A	DM0HPWY	Investigative	biochanin A increases the activity of Creatine kinase B-type (CKB).	[46]

References

• [1] Diverse proteomic alterations in gastric adenocarcinoma.Proteomics. 2004 Oct;4(10):3276-87. doi: 10.1002/pmic.200300916.
• [2] Knockdown of creatine kinase B inhibits ovarian cancer progression by decreasing glycolysis.Int J Biochem Cell Biol. 2013 May;45(5):979-86. doi: 10.1016/j.biocel.2013.02.003. Epub 2013 Feb 14.
• [3] Differences in structure and function between human and murine tau.Biochim Biophys Acta Mol Basis Dis. 2019 Aug 1;1865(8):2024-2030. doi: 10.1016/j.bbadis.2018.08.010. Epub 2018 Aug 12.
• [4] Construction of phage display libraries from reactive lymph nodes of breast carcinoma patients and selection for specifically binding human single chain Fv on cell lines.Int J Mol Med. 2004 Oct;14(4):729-35. doi: 10.3892/ijmm.14.4.729.
• [5] Creatine kinase brain overexpression protects colorectal cells from various metabolic and non-metabolic stresses.J Cell Biochem. 2011 Apr;112(4):1066-75. doi: 10.1002/jcb.23020.
• [6] Selective induction of chromosomal gene expression by human cytomegalovirus.Virology. 1988 Sep;166(1):217-28. doi: 10.1016/0042-6822(88)90163-8.
• [7] Dysregulated brain creatine kinase is associated with hearing impairment in mouse models of Huntington disease.J Clin Invest. 2011 Apr;121(4):1519-23. doi: 10.1172/JCI43220. Epub 2011 Mar 14.
• [8] Increased creatine kinase BB activity and CKB mRNA expression in patients with hematologic disorders: relation to methylation status of the CKB promoter.Clin Chim Acta. 2005 Nov;361(1-2):135-40. doi: 10.1016/j.cccn.2005.05.028.
• [9] Enhancement of brain-type creatine kinase activity ameliorates neuronal deficits in Huntington's disease.Biochim Biophys Acta. 2013 Jun;1832(6):742-53. doi: 10.1016/j.bbadis.2013.02.006. Epub 2013 Feb 15.
• [10] Utility of troponin I in patients with cocaine-associated chest pain. Acad Emerg Med. 2002 Oct;9(10):1007-13. doi: 10.1111/j.1553-2712.2002.tb02134.x.
• [11] The expression of creatine kinase isoenzymes in neocortex of patients with neurodegenerative disorders: Alzheimer's and Pick's disease.Exp Neurol. 1997 Aug;146(2):458-65. doi: 10.1006/exnr.1997.6550.
• [12] Deregulated Expression of SRC, LYN and CKB Kinases by DNA Methylation and Its Potential Role in Gastric Cancer Invasiveness and Metastasis.PLoS One. 2015 Oct 13;10(10):e0140492. doi: 10.1371/journal.pone.0140492. eCollection 2015.
• [13] Proteomic surveillance of retinal autoantigens in endogenous uveitis: implication of esterase D and brain-type creatine kinase as novel autoantigens.Mol Vis. 2008 Jun 12;14:1094-104.
• [14] Prostaglandin E1, E2, and cholera toxin increase transcription of the brain creatine kinase gene in human U87 glioblastoma cells.Glia. 1995 Dec;15(4):471-9. doi: 10.1002/glia.440150410.
• [15] Extracellular metabolic energetics can promote cancer progression. Cell. 2015 Jan 29;160(3):393-406.
• [16] Roles of interferon-gamma and its target genes in schizophrenia: Proteomics-based reverse genetics from mouse to human.Proteomics. 2012 Jun;12(11):1815-29. doi: 10.1002/pmic.201100184.
• [17] The association between sleep duration, snoring and prevalent type 2 diabetes mellitus with regard to gender and menopausal status: the CKB study in Zhejiang rural area, China.Acta Diabetol. 2017 Jan;54(1):81-90. doi: 10.1007/s00592-016-0918-1. Epub 2016 Sep 24.
• [18] The relationship between trace elements and cardiac markers in acute coronary syndromes.J Trace Elem Med Biol. 2005;18(3):235-42. doi: 10.1016/j.jtemb.2004.12.002.
• [19] Creatine kinase B is a target molecule of reactive oxygen species in cervical cancer.Mol Cells. 2001 Dec 31;12(3):412-7.
• [20] Altered expression and localization of creatine kinase B, heterogeneous nuclear ribonucleoprotein F, and high mobility group box 1 protein in the nuclear matrix associated with colon cancer.Cancer Res. 2006 Jan 15;66(2):763-9. doi: 10.1158/0008-5472.CAN-05-3771.
• [21] Low oxygen tension enhances hepatitis C virus replication.J Virol. 2013 Mar;87(5):2935-48. doi: 10.1128/JVI.02534-12. Epub 2012 Dec 26.
• [22] Creatine kinase brain isoenzyme in infantile osteopetrosis.Pediatr Neurol. 1987 Jan-Feb;3(1):54-7. doi: 10.1016/0887-8994(87)90057-9.
• [23] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [24] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [25] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [26] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [27] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [28] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [29] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [30] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [31] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [32] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [33] Arsenic targets Pin1 and cooperates with retinoic acid to inhibit cancer-driving pathways and tumor-initiating cells. Nat Commun. 2018 Aug 9;9(1):3069. doi: 10.1038/s41467-018-05402-2.
• [34] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [35] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [36] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [37] Genomic and proteomic analysis of the effects of cannabinoids on normal human astrocytes. Brain Res. 2008 Jan 29;1191:1-11.
• [38] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [39] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [40] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [41] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [42] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [43] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [44] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [45] Comparative study of the neurotoxicological effects of tramadol and tapentadol in SH-SY5Y cells. Toxicology. 2016 Jun 1;359-360:1-10. doi: 10.1016/j.tox.2016.06.010. Epub 2016 Jun 15.
• [46] Responsiveness to estradiol-17beta and to phytoestrogens in primary human osteoblasts is modulated differentially by high glucose concentration. J Steroid Biochem Mol Biol. 2006 May;99(2-3):139-46. doi: 10.1016/j.jsbmb.2005.12.008. Epub 2006 Apr 18.
• [47] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [50] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [51] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [52] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [53] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [54] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [55] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [56] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [57] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [58] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [59] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [60] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [61] High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.