Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTFLHJV)

DTT Name Multidrug resistance-associated protein 2 (ABCC2)
Synonyms
MRP2; Canalicular multispecific organic anion transporter 1; Canalicular multidrug resistance protein; CMRP; CMOAT1; CMOAT; ATP-binding cassette, sub-family C, member 2; ATP-binding cassette sub-family C member 2
Gene Name ABCC2
DTT Type
Literature-reported target
 [1]
BioChemical Class
ABC transporter
UniProt ID
MRP2_HUMAN
TTD ID
T61792
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 7.6.2.2
Sequence
MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSS
TTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYS
RQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILI
FSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVS
KFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSG
TKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIG
YLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGET
VNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAIL
STKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFS
QLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMI
SSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD
IMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNIL
FGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLD
IYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIV
EKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAAS
ITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETG
KVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQR
DMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRI
VNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMF
YVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSW
ITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTS
EIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGI
TCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTII
PQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIG
QRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMD
SDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF
Function May function as a cellular cisplatin transporter. Mediates hepatobiliary excretion of numerous organic anions.
KEGG Pathway
ABC transporters (hsa02010 )
Bile secretion (hsa04976 )
Reactome Pathway
ABC-family proteins mediated transport (R-HSA-382556 )

The Drug Transporter (DTP) Role of This DTT

DTT DTP Name Multidrug resistance-associated protein 2 (ABCC2) DTP Info
Gene Name ABCC2
74 Approved Drug(s) Transported by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acetaminophen DMUIE76 Allergic rhinitis CA08.0 Approved [2]
Aciclovir DMYLOVR Genital herpes 1A94 Approved [3]
Adefovir DMM278X N. A. N. A. Approved [4]
Ampicillin DMHWE7P Acute epiglottitis Approved [5]
Arsenic trioxide DM61TA4 Acute lymphoblastic leukaemia 2A85 Approved [6]
Carbamazepine DMZOLBI Epilepsy 8A60-8A68 Approved [7]
Cefadroxil DMMC345 Bacterial infection 1A00-1C4Z Approved [8]
Cefodizime DMORSGU N. A. N. A. Approved [5]
Ceftriaxone DMCEW64 Acute gonococcal cervicitis Approved [5]
Cerivastatin DMXCM7H Hyperlipidaemia 5C80 Approved [9]
Cholic Acid DM7OKQV Cholelithiasis DC11 Approved [10]
Ciclosporin DMAZJFX Graft-versus-host disease 4B24 Approved [11]
Cidofovir DMA13GD Cytomegalovirus infection 1D82 Approved [5]
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [12]
Dehydroepiandrosterone sulfate DM4Q80H N. A. N. A. Approved [13]
Dinoprostone DMTYOPD Medical abortion JA00.1Z Approved [14]
Docetaxel DMDI269 Advanced cancer 2A00-2F9Z Approved [15]
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [16]
Enalapril DMNFUZR Congestive heart failure BD10 Approved [17]
Epirubicin DMPDW6T Solid tumour/cancer 2A00-2F9Z Approved [5]
Erythromycin DM4K7GQ Acne vulgaris ED80 Approved [18]
Estrone sulfate DMVBIZL Atrophic vaginitis GA30.2 Approved [19]
Etoposide DMNH3PG Acute myelogenous leukaemia 2A41 Approved [20]
Ezetimibe DM7A8TW Atherosclerosis BD40 Approved [21]
FLUORESCEIN DMQTFAO Ocular disease 1F00.1Z Approved [22]
Fluorouracil DMUM7HZ Adenocarcinoma 2D40 Approved [23]
Folic Acid DMEMBJC Colorectal carcinoma Approved [24]
Gadobenate Dimeglumine DM4VAOG Schizophrenia 6A20 Approved [25]
Gatifloxacin DMSL679 Acute gonococcal cervicitis Approved [26]
Gemifloxacin DMHT34O Bacterial infection 1A00-1C4Z Approved [27]
Glutathione DMAHMT9 Human immunodeficiency virus infection 1C62 Approved [28]
Grepafloxacin DMGLX0T Chronic bronchitis CA20.1 Approved [29]
Indinavir DM0T3YH Human immunodeficiency virus infection 1C62 Approved [30]
Irinotecan DMP6SC2 Adenocarcinoma 2D40 Approved [31]
Leucovorin DMUAZWG Colon adenocarcinoma Approved [32]
Lopinavir DMITQS0 Human immunodeficiency virus infection 1C62 Approved [33]
Mesalazine DMOL5IU Diverticulitis Approved [34]
Methotrexate DM2TEOL Anterior urethra cancer Approved [35]
Mitoxantrone DMM39BF Acute myelogenous leukaemia 2A41 Approved [5]
Mycophenolate mofetil DMPQAGE Hepatosplenic T-cell lymphoma Approved [36]
Mycophenolic acid DMRBMAU Crohn disease DD70 Approved [37]
Nilotinib DM7HXWT Chronic myelogenous leukaemia 2A20.0 Approved [38]
Octreotide DMHIDCJ Acromegaly 5A60.0 Approved [39]
Olamufloxacin DMQ4PKA N. A. N. A. Approved [40]
Olmesartan medoxomil DMWBHRY High blood pressure BA00 Approved [41]
Oxaliplatin DMQNWRD Adenocarcinoma 2D40 Approved [42]
Paclitaxel DMLB81S Breast carcinoma Approved [43]
Pemetrexed DMMX2E6 Central nervous system lymphoma 2B33.5 Approved [40]
Pemirolast DML97WV Allergic conjunctivitis 9A60.02 Approved [40]
Phenobarbital DMXZOCG Cluster headache 8A81.0 Approved [44]
Phenytoin DMNOKBV Epilepsy 8A60-8A68 Approved [45]
Pitavastatin DMJH792 Hypercholesterolaemia 5C80.0 Approved [46]
PITAVASTATIN CALCIUM DM1UJO0 Dyslipidemia 5C80-5C81 Approved [5]
Pravastatin DM6A0X7 Adult acute monocytic leukemia Approved [47]
Probenecid DMMFWOJ Acute gonococcal cervicitis Approved [48]
Raltitrexed DMT9K8G Rectal adenocarcinoma 2B92 Approved [49]
Regorafenib DMHSY1I Gastrointestinal stromal tumour 2B5B Approved [50]
Rifampin DMA8J1G Tuberculosis 1B10-1B1Z Approved [51]
Ritonavir DMU764S Human immunodeficiency virus infection 1C62 Approved [30]
Rosuvastatin DMMIQ7G Arteriosclerosis BD40 Approved [52]
Saquinavir DMG814N Human immunodeficiency virus infection 1C62 Approved [53]
Sorafenib DMS8IFC Adenocarcinoma 2D40 Approved [54]
Succimer DME81IY Metal intoxication NE60 Approved [55]
Sulfasalazine DMICA9H Irritable bowel syndrome DD91.0 Approved [56]
Sulfinpyrazone DMEV954 Gout FA25 Approved [57]
Technetium (99MTC) mebrofenin DMUEWM3 N. A. N. A. Approved [5]
Telithromycin DMZ4P3A Bacterial infection 1A00-1C4Z Approved [16]
Temocaprilate DMNX2QI N. A. N. A. Approved [5]
Valproate DMCFE9I Epilepsy 8A60-8A68 Approved [4]
Valsartan DMREUQ6 Chronic heart failure BD1Z Approved [58]
Vasopressin DMQ2FPC Diabetes insipidus 5A61.5 Approved [59]
Vinblastine DM5TVS3 Advanced cancer 2A00-2F9Z Approved [60]
Vincristine DMINOX3 Acute lymphoblastic leukaemia 2A85 Approved [5]
VRX496 DMIO4V5 Acquired immune deficiency syndrome 1C62.3 Approved [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 74 Approved Drug(s)
9 Clinical Trial Drug(s) Transported by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Camptothecin DM6CHNJ Solid tumour/cancer 2A00-2F9Z Phase 3 [4]
GLYCYRRHIZIN DM8M2N3 Influenza virus infection 1E30-1E32 Phase 3 [40]
BQ-123 DM0MO8I Pulmonary arterial hypertension BB01.0 Phase 2 [40]
CKD602 DMW9F1G Solid tumour/cancer 2A00-2F9Z Phase 2 [40]
Glutathione-S-S-glutathione DMJ85FS N. A. N. A. Phase 2 [61]
LE-SN38 DMW50NF Colorectal cancer 2B91.Z Phase 2 [62]
PEITC DMOMN31 Prostate cancer 2C82.0 Phase 2 [63]
EPICATECHIN DMN0EMP Duchenne dystrophy 8C70 Phase 1/2 [64]
Sodium taurocholate DM3GO0J Type-2 diabetes 5A11 Phase 1/2 [65]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Clinical Trial Drug(s)
2 Discontinued Drug(s) Transported by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phenolphthalein DM5SICT Constipation DD91.1 Withdrawn from market [66]
Rhodamine-123 DMQAK6T Prostate cancer 2C82.0 Discontinued in Phase 1 [67]
------------------------------------------------------------------------------------
3 Preclinical Drug(s) Transported by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Alpha-Zearalenol DMQMAWK N. A. N. A. Preclinical [68]
Scutellarin DMJT1E5 N. A. N. A. Preclinical [69]
Taxifolin DMQJSF9 N. A. N. A. Preclinical [70]
------------------------------------------------------------------------------------
11 Investigative Drug(s) Transported by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
AMINOHIPPURIC ACID DMUN54G Discovery agent N.A. Investigative [71]
bilirubin DMI0V4O Discovery agent N.A. Investigative [72]
CCK-8 DMN0J4W N. A. N. A. Investigative [19]
chelerythrine DMCP1G9 Discovery agent N.A. Investigative [40]
Genistein-7-glucoside DMMLNTW N. A. N. A. Investigative [5]
glycocholic acid DM0SXNM Discovery agent N.A. Investigative [73]
N5-methylfolate DML0R9M Discovery agent N.A. Investigative [40]
Phlorizin DMNARGO Discovery agent N.A. Investigative [5]
talinolol DMRTD16 Discovery agent N.A. Investigative [74]
tauroursodeoxycholic acid DMFKRQE Discovery agent N.A. Investigative [75]
[3H]estradiol-17beta-glucuronide DM3KJ45 Discovery agent N.A. Investigative [76]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Investigative Drug(s)

References

1 Targeting an extracellular epitope of the human multidrug resistance protein 1 (MRP1) in malignant cells with a novel recombinant single chain Fv a... Int J Cancer. 2004 Jul 20;110(6):882-90.
2 Effect of acetaminophen on expression and activity of rat liver multidrug resistance-associated protein 2 and P-glycoprotein. Biochem Pharmacol. 2004 Aug 15;68(4):791-8.
3 Gene expression in the human intestine and correlation with oral valacyclovir pharmacokinetic parameters. J Pharmacol Exp Ther. 2003 Aug;306(2):778-86.
4 Pharmacogenetics of membrane transporters: an update on current approaches. Mol Biotechnol. 2010 Feb;44(2):152-67.
5 Mammalian drug efflux transporters of the ATP binding cassette (ABC) family in multidrug resistance: A review of the past decade. Cancer Lett. 2016 Jan 1;370(1):153-64.
6 MRP2 and acquired tolerance to inorganic arsenic in the kidney of killifish (Fundulus heteroclitus). Toxicol Sci. 2007 May;97(1):103-10.
7 A nonsynonymous variation in MRP2/ABCC2 is associated with neurological adverse drug reactions of carbamazepine in patients with epilepsy. Pharmacogenet Genomics. 2010 Apr;20(4):249-56.
8 Oral availability of cefadroxil depends on ABCC3 and ABCC4. Drug Metab Dispos. 2012 Mar;40(3):515-21.
9 Identification of the hepatic efflux transporters of organic anions using double-transfected Madin-Darby canine kidney II cells expressing human organic anion-transporting polypeptide 1B1 (OATP1B1)/multidrug resistance-associated protein 2, OATP1B1/multidrug resistance 1, and OATP1B1/breast cancer resistance protein. J Pharmacol Exp Ther. 2005 Sep;314(3):1059-67.
10 Multiple pathways for fluoroquinolone secretion by human intestinal epithelial (Caco-2) cells. Br J Pharmacol. 2002 Mar;135(5):1263-75.
11 Is cyclosporine A transport inhibited by pravastatin via multidrug resistant protein 2? Eur J Clin Pharmacol. 2010 Feb;66(2):153-8.
12 Lentivirus-mediated RNAi silencing targeting ABCC2 increasing the sensitivity of a human nasopharyngeal carcinoma cell line against cisplatin. J Transl Med. 2008 Oct 4;6:55.
13 Directional trans-epithelial transport of organic anions in porcine LLC-PK1 cells that co-express human OATP1B1 (OATP-C) and MRP2. Biochem Pharmacol. 2005 Feb 1;69(3):415-23.
14 Multidrug resistance associated protein 2 mediates transport of prostaglandin E2. Liver Int. 2006 Apr;26(3):362-8.
15 Transport of diclofenac by breast cancer resistance protein (ABCG2) and stimulation of multidrug resistance protein 2 (ABCC2)-mediated drug transport by diclofenac and benzbromarone. Drug Metab Dispos. 2009 Jan;37(1):129-36.
16 Involvement of the drug transporters p glycoprotein and multidrug resistance-associated protein Mrp2 in telithromycin transport. Antimicrob Agents Chemother. 2006 Jan;50(1):80-7.
17 Vectorial transport of enalapril by Oatp1a1/Mrp2 and OATP1B1 and OATP1B3/MRP2 in rat and human livers. J Pharmacol Exp Ther. 2006 Jul;318(1):395-402.
18 Effect of ABCC2 (MRP2) transport function on erythromycin metabolism. Clin Pharmacol Ther. 2011 May;89(5):693-701.
19 Human hepatobiliary transport of organic anions analyzed by quadruple-transfected cells. Mol Pharmacol. 2005 Oct;68(4):1031-8.
20 Delineating the contribution of secretory transporters in the efflux of etoposide using Madin-Darby canine kidney (MDCK) cells overexpressing P-glycoprotein (Pgp), multidrug resistance-associated protein (MRP1), and canalicular multispecific organic anion transporter (cMOAT). Drug Metab Dispos. 2002 Apr;30(4):457-63.
21 Intestinal expression of P-glycoprotein (ABCB1), multidrug resistance associated protein 2 (ABCC2), and uridine diphosphate-glucuronosyltransferase 1A1 predicts the disposition and modulates the effects of the cholesterol absorption inhibitor ezetimibe in humans. Clin Pharmacol Ther. 2006 Mar;79(3):206-17.
22 Phosphoinositide 3-kinase/protein kinase B signaling pathway is involved in estradiol 17-D-glucuronide-induced cholestasis: complementarity with classical protein kinase C. Hepatology. 2010 Oct;52(4):1465-76.
23 Enhancing chemosensitivity in oral squamous cell carcinoma by lentivirus vector-mediated RNA interference targeting EGFR and MRP2. Oncol Lett. 2016 Sep;12(3):2107-2114.
24 Mammalian multidrug-resistance proteins (MRPs). Essays Biochem. 2011 Sep 7;50(1):179-207.
25 Liver Perfusion Modifies Gd-DTPA and Gd-BOPTA Hepatocyte Concentrations Through Transfer Clearances Across Sinusoidal Membranes. Eur J Drug Metab Pharmacokinet. 2017 Aug;42(4):657-667.
26 Uptake and intracellular release kinetics of liposome formulations in glioma cells. Int J Pharm. 2010 Aug 16;395(1-2):251-9.
27 Differential effect of P-gp and MRP2 on cellular translocation of gemifloxacin. Int J Pharm. 2011 Nov 25;420(1):26-33.
28 Oxidative and electrophilic stress induces multidrug resistance-associated protein transporters via the nuclear factor-E2-related factor-2 transcriptional pathway. Hepatology. 2007 Nov;46(5):1597-610.
29 Fluoroquinolone efflux mediated by ABC transporters. J Pharm Sci. 2008 Sep;97(9):3483-93.
30 Interaction of eight HIV protease inhibitors with the canalicular efflux transporter ABCC2 (MRP2) in sandwich-cultured rat and human hepatocytes. Biopharm Drug Dispos. 2010 Mar;31(2-3):178-88.
31 Intestinal transport of irinotecan in Caco-2 cells and MDCK II cells overexpressing efflux transporters Pgp, cMOAT, and MRP1. Drug Metab Dispos. 2002 Jul;30(7):763-70.
32 Transport of methotrexate, methotrexate polyglutamates, and 17beta-estradiol 17-(beta-D-glucuronide) by ABCG2: effects of acquired mutations at R482 on methotrexate transport. Cancer Res. 2003 Jul 15;63(14):4048-54.
33 Effects of cytochrome P450 3A (CYP3A) and the drug transporters P-glycoprotein (MDR1/ABCB1) and MRP2 (ABCC2) on the pharmacokinetics of lopinavir. Br J Pharmacol. 2010 Jul;160(5):1224-33.
34 Transport studies with 5-aminosalicylate. Eur J Clin Pharmacol. 2006 Oct;62(10):871-5.
35 Dose-dependent disposition of methotrexate in Abcc2 and Abcc3 gene knockout murine models. Drug Metab Dispos. 2011 Nov;39(11):2155-61.
36 Influence of SLCO1B1, 1B3, 2B1 and ABCC2 genetic polymorphisms on mycophenolic acid pharmacokinetics in Japanese renal transplant recipients. Eur J Clin Pharmacol. 2007 Dec;63(12):1161-9.
37 C-440T/T-331C polymorphisms in the UGT1A9 gene affect the pharmacokinetics of mycophenolic acid in kidney transplantation. Pharmacogenomics. 2007 Sep;8(9):1127-41.
38 Interaction of nilotinib, dasatinib and bosutinib with ABCB1 and ABCG2: implications for altered anti-cancer effects and pharmacological properties. Br J Pharmacol. 2009 Oct;158(4):1153-64.
39 P-glycoprotein- and mrp2-mediated octreotide transport in renal proximal tubule. Br J Pharmacol. 2000 Jan;129(2):251-6.
40 Human intestinal transporter database: QSAR modeling and virtual profiling of drug uptake, efflux and interactions. Pharm Res. 2013 Apr;30(4):996-1007.
41 Multiple human isoforms of drug transporters contribute to the hepatic and renal transport of olmesartan, a selective antagonist of the angiotensin II AT1-receptor. Drug Metab Dispos. 2007 Dec;35(12):2166-76.
42 Multidrug Resistance-Associated Protein 2 (MRP2) Mediated Transport of Oxaliplatin-Derived Platinum in Membrane Vesicles. PLoS One. 2015 Jul 1;10(7):e0130727.
43 Multidrug resistance protein 2 is an important determinant of paclitaxel pharmacokinetics. Clin Cancer Res. 2006 Oct 15;12(20 Pt 1):6125-32.
44 Regulation of multidrug resistance-associated protein 2 (ABCC2) by the nuclear receptors pregnane X receptor, farnesoid X-activated receptor, and constitutive androstane receptor. J Biol Chem. 2002 Jan 25;277(4):2908-15.
45 Upregulation of brain expression of P-glycoprotein in MRP2-deficient TR(-) rats resembles seizure-induced up-regulation of this drug efflux transporter in normal rats. Epilepsia. 2007 Apr;48(4):631-45.
46 Involvement of BCRP (ABCG2) in the biliary excretion of pitavastatin. Mol Pharmacol. 2005 Sep;68(3):800-7.
47 Role of transporters in the tissue-selective distribution and elimination of drugs: transporters in the liver, small intestine, brain and kidney. J Control Release. 2002 Jan 17;78(1-3):43-54.
48 MRP2 (ABCC2) transports taxanes and confers paclitaxel resistance and both processes are stimulated by probenecid. Int J Cancer. 2005 Sep 20;116(5):824-9.
49 Antifolate resistance mediated by the multidrug resistance proteins MRP1 and MRP2. Cancer Res. 1999 Jun 1;59(11):2532-5.
50 Regorafenib is transported by the organic anion transporter 1B1 and the multidrug resistance protein 2. Biol Pharm Bull. 2015;38(4):582-6.
51 Expression and distribution of CYP3A genes, CYP2B22, and MDR1, MRP1, MRP2, LRP efflux transporters in brain of control and rifampicin-treated pigs. Mol Cell Biochem. 2010 Apr;337(1-2):133-43.
52 Involvement of multiple transporters in the hepatobiliary transport of rosuvastatin. Drug Metab Dispos. 2008 Oct;36(10):2014-23.
53 Evidence for two interacting ligand binding sites in human multidrug resistance protein 2 (ATP binding cassette C2). J Biol Chem. 2003 Jun 27;278(26):23538-44.
54 Multidrug resistance protein 2 implicates anticancer drug-resistance to sorafenib. Biol Pharm Bull. 2011;34(3):433-5.
55 MRP2 involvement in renal proximal tubular elimination of methylmercury mediated by DMPS or DMSA. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):10-7.
56 Small intestinal efflux mediated by MRP2 and BCRP shifts sulfasalazine intestinal permeability from high to low, enabling its colonic targeting. Am J Physiol Gastrointest Liver Physiol. 2009 Aug;297(2):G371-7.
57 Vinblastine and sulfinpyrazone export by the multidrug resistance protein MRP2 is associated with glutathione export. Br J Cancer. 2000 Aug;83(3):375-83.
58 Involvement of transporters in the hepatic uptake and biliary excretion of valsartan, a selective antagonist of the angiotensin II AT1-receptor, in humans. Drug Metab Dispos. 2006 Jul;34(7):1247-54.
59 Transport function and hepatocellular localization of mrp6 in rat liver. Mol Pharmacol. 2000 Mar;57(3):634-41.
60 Severe hypokalemia due to a possible drug-drug interaction between vinblastine and antiretrovirals in a HIV-infected patient with Hodgkin's lymphoma. Int J STD AIDS. 2017 Oct;28(12):1259-1262.
61 Purification of the human apical conjugate export pump MRP2 reconstitution and functional characterization as substrate-stimulated ATPase. Eur J Biochem. 1999 Oct 1;265(1):281-9.
62 Biliary excretion mechanism of CPT-11 and its metabolites in humans: involvement of primary active transporters. Cancer Res. 1998 Nov 15;58(22):5137-43.
63 Transport of dietary phenethyl isothiocyanate is mediated by multidrug resistance protein 2 but not P-glycoprotein. Biochem Pharmacol. 2005 Aug 15;70(4):640-7.
64 Transport and metabolism of the tea flavonoid (-)-epicatechin by the human intestinal cell line Caco-2. Pharm Res. 2001 Oct;18(10):1420-5.
65 Functional analysis of ABCA8, a new drug transporter. Biochem Biophys Res Commun. 2002 Oct 18;298(1):41-5.
66 Biliary excretion of phenolphthalein sulfate in rats. Pharmacology. 2003 Aug;68(4):177-82.
67 Characterization of rhodamine-123, calcein and 5(6)-carboxy-2',7'-dichlorofluorescein (CDCF) export via MRP2 (ABCC2) in MES-SA and A549 cells. Eur J Pharm Sci. 2011 Aug 17;43(5):359-69.
68 ABCC1, ABCC2 and ABCC3 are implicated in the transepithelial transport of the myco-estrogen zearalenone and its major metabolites. Toxicol Lett. 2009 Oct 28;190(2):215-23.
69 Mechanistic studies on the absorption and disposition of scutellarin in humans: selective OATP2B1-mediated hepatic uptake is a likely key determinant for its unique pharmacokinetic characteristics. Drug Metab Dispos. 2012 Oct;40(10):2009-20.
70 Permeation of astilbin and taxifolin in Caco-2 cell and their effects on the P-gp. Int J Pharm. 2009 Aug 13;378(1-2):1-8.
71 ATP-dependent para-aminohippurate transport by apical multidrug resistance protein MRP2. Kidney Int. 2000 Apr;57(4):1636-42.
72 Transport of monoglucuronosyl and bisglucuronosyl bilirubin by recombinant human and rat multidrug resistance protein 2. Hepatology. 1999 Aug;30(2):485-90.
73 Differential modulation of the human liver conjugate transporters MRP2 and MRP3 by bile acids and organic anions. J Biol Chem. 2003 Jun 27;278(26):23529-37.
74 FDA Drug Development and Drug Interactions
75 Human multidrug resistance protein 2 transports the therapeutic bile salt tauroursodeoxycholate. J Pharmacol Exp Ther. 2007 Feb;320(2):893-9.
76 Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells. Mol Pharmacol. 1999 May;55(5):929-37.