Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE492CE)

DME Name	Prostaglandin G/H synthase 2 (COX-2)
Synonyms	Prostaglandin H2 synthase 2; Prostaglandin-endoperoxide synthase 2; Cyclooxygenase-2; PGH synthase 2; COX-2; COX2; PGHS-2; PHS II; PTGS2
Gene Name	PTGS2
UniProt ID	PGH2_HUMAN
INTEDE ID	DME0114
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	5743
EC Number	EC: 1.14.99.1 Oxidoreductase Oxygen paired donor oxidoreductase Oxygen paired donor oxidoreductase EC: 1.14.99.1
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER STEL
Function	This enzyme converts arachidonate to prostaglandin H2 (PGH2).
KEGG Pathway	Alzheimer's disease (hsa05010 ) Arachidonic acid metabolism (hsa00590 ) C-type lectin receptor signaling pathway (hsa04625 ) Chemical carcinogenesis (hsa05204 ) Human cytomegalovirus infection (hsa05163 ) Human papillomavirus infection (hsa05165 ) IL-17 signaling pathway (hsa04657 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Leishmaniasis (hsa05140 ) Metabolic pathways (hsa01100 ) MicroRNAs in cancer (hsa05206 ) NF-kappa B signaling pathway (hsa04064 ) Ovarian steroidogenesis (hsa04913 ) Oxytocin signaling pathway (hsa04921 ) Pathways in cancer (hsa05200 ) Regulation of lipolysis in adipocytes (hsa04923 ) Retrograde endocannabinoid signaling (hsa04723 ) Serotonergic synapse (hsa04726 ) Small cell lung cancer (hsa05222 ) TNF signaling pathway (hsa04668 ) VEGF signaling pathway (hsa04370 )
Reactome Pathway	Biosynthesis of DPAn-3 SPMs (R-HSA-9025094 ) Biosynthesis of EPA-derived SPMs (R-HSA-9018679 ) Biosynthesis of electrophilic Omega-3 PUFA oxo-derivatives (R-HSA-9027604 ) Interleukin-10 signaling (R-HSA-6783783 ) Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 ) Nicotinamide salvaging (R-HSA-197264 ) Synthesis of 15-eicosatetraenoic acid derivatives (R-HSA-2142770 ) Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123 ) Biosynthesis of DHA-derived SPMs (R-HSA-9018677 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DME

6 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dapsone	DM4LT8A	Acne vulgaris	ED80	Approved	[118]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Hypertriglyceridemia	5C80.1	Approved	[119]
Epanova	DMHEAGL	Hypertriglyceridemia	5C80.1	Approved	[120]
Etoposide	DMNH3PG	Acute myelogenous leukaemia	2A41	Approved	[121]
Gamma-Homolinolenic acid	DMSXKYG	Malnutrition	5B50-5B71	Approved	[119]
Gamolenic acid	DMQN30Z	Allergy	4A80-4A85	Approved	[119]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Approved Drug(s)

1 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Omega-6-FA	DMBWY8V	N. A.	N. A.	Phase 3	[122]
------------------------------------------------------------------------------------

5 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
alpha-linolenic acid	DMY64HE	Discovery agent	N.A.	Investigative	[119]
Arachidonic Acid	DMUOQZD	Discovery agent	N.A.	Investigative	[123]
BML3-C01	DMER2WS	N. A.	N. A.	Investigative	[119]
Eicosadienoic acid	DMVJK9W	N. A.	N. A.	Investigative	[119]
Icosapentum	DMF1CM7	N. A.	N. A.	Investigative	[119]
------------------------------------------------------------------------------------

Experimental Enzyme Kinetic Data of Drugs

Drug Name	Indication	Highest Status	Kinetic Data	REF
alpha-linolenic acid	Discovery agent [N.A.]	Investigative	Km = 0.0031 microM	[119]
Arachidonic Acid	Discovery agent [N.A.]	Investigative	Km = 0.0017 microM	[119]
Eicosapentaenoic acid/docosa-hexaenoic acid	Hypertriglyceridemia [5C80.1]	Approved	Km = 0.0011 microM	[119]
Gamma-Homolinolenic acid	Malnutrition [5B50-5B71]	Approved	Km = 0.002 microM	[119]
Gamolenic acid	Allergy [4A80-4A85]	Approved	Km = 0.0048 microM	[119]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	1.38E-09	-1.44E+00	-9.15E-01
Alopecia	ED70	Skin from scalp	5.15E-04	1.49E-01	4.78E-01
Alzheimer's disease	8A20	Entorhinal cortex	7.93E-04	-2.88E-01	-3.44E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	9.00E-01	-6.26E-02	-2.65E-01
Aortic stenosis	BB70	Calcified aortic valve	3.40E-03	-8.53E-01	-1.54E+00
Apnea	7A40	Hyperplastic tonsil	2.60E-01	-2.39E-01	-3.66E-01
Arthropathy	FA00-FA5Z	Peripheral blood	8.20E-02	2.19E-01	3.53E-01
Asthma	CA23	Nasal and bronchial airway	1.50E-04	8.64E-01	6.35E-01
Atopic dermatitis	EA80	Skin	1.62E-01	-3.10E-01	-1.11E+00
Autism	6A02	Whole blood	6.28E-01	8.65E-02	7.86E-02
Autoimmune uveitis	9A96	Peripheral monocyte	6.38E-01	-5.21E-01	-3.95E-01
Autosomal dominant monocytopenia	4B04	Whole blood	1.82E-02	-6.87E-01	-1.53E+00
Bacterial infection of gingival	1C1H	Gingival tissue	1.97E-06	7.14E-01	8.33E-01
Batten disease	5C56.1	Whole blood	6.55E-02	6.91E-01	1.03E+00
Behcet's disease	4A62	Peripheral blood	6.30E-01	1.24E-01	6.12E-02
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	4.14E-01	5.95E-02	6.69E-02
Bladder cancer	2C94	Bladder tissue	5.95E-02	6.63E-01	7.42E-01
Breast cancer	2C60-2C6Z	Breast tissue	1.55E-33	-1.09E+00	-8.69E-01
Cardioembolic stroke	8B11.20	Whole blood	1.59E-04	5.88E-01	1.00E+00
Cervical cancer	2C77	Cervical tissue	6.82E-03	1.44E+00	9.40E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	8.16E-01	-1.16E+00	-4.27E-01
Chronic hepatitis C	1E51.1	Whole blood	2.29E-01	2.55E-01	8.68E-02
Chronic obstructive pulmonary disease	CA22	Lung tissue	1.95E-01	1.73E-01	1.60E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.21E-01	1.41E-01	1.99E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	8.63E-02	-1.18E+00	-1.25E+00
Colon cancer	2B90	Colon tissue	1.64E-44	1.57E+00	1.70E+00
Coronary artery disease	BA80-BA8Z	Peripheral blood	3.19E-01	2.19E+00	9.57E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	2.92E-01	-5.17E-02	-2.33E-01
Endometriosis	GA10	Endometrium tissue	1.40E-01	-9.05E-01	-5.03E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	1.75E-01	1.16E-01	8.46E-01
Familial hypercholesterolemia	5C80.00	Whole blood	2.53E-03	-1.03E+00	-1.57E+00
Gastric cancer	2B72	Gastric tissue	3.16E-01	1.72E+00	8.08E-01
Glioblastopma	2A00.00	Nervous tissue	5.47E-01	-1.46E-01	-1.42E-01
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	7.58E-02	3.46E-01	1.66E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	9.74E-01	2.26E-01	1.78E-01
Head and neck cancer	2D42	Head and neck tissue	6.31E-32	2.41E+00	2.47E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	4.76E-02	1.27E-01	3.54E-01
Huntington's disease	8A01.10	Whole blood	1.73E-01	1.01E+00	9.22E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	4.65E-02	-8.86E-01	-9.34E-01
Immunodeficiency	4A00-4A20	Peripheral blood	1.94E-03	5.72E-02	1.02E+00
Influenza	1E30	Whole blood	2.31E-01	-3.08E-01	-3.14E+00
Interstitial cystitis	GC00.3	Bladder tissue	9.47E-03	1.08E+00	1.92E+00
Intracranial aneurysm	8B01.0	Intracranial artery	3.30E-01	6.96E-01	4.04E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	2.90E-02	5.40E-02	1.84E-01
Ischemic stroke	8B11	Peripheral blood	2.48E-02	1.17E+00	3.89E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	1.83E-08	9.57E-01	1.09E+00
Lateral sclerosis	8B60.4	Skin	1.02E-02	-8.42E-01	-2.67E+00
Lateral sclerosis	8B60.4	Cervical spinal cord	6.47E-01	5.38E-02	1.47E-01
Liver cancer	2C12.0	Liver tissue	4.32E-06	-1.04E+00	-1.03E+00
Liver failure	DB99.7-DB99.8	Liver tissue	9.73E-01	4.92E-01	3.65E-01
Lung cancer	2C25	Lung tissue	2.54E-27	-1.16E+00	-9.90E-01
Lupus erythematosus	4A40	Whole blood	6.85E-03	4.86E-01	3.21E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	7.54E-01	-4.80E-01	-5.41E-01
Major depressive disorder	6A70-6A7Z	Whole blood	5.95E-01	1.23E-01	1.79E-01
Melanoma	2C30	Skin	1.13E-01	3.14E-01	2.60E-01
Multiple myeloma	2A83.1	Peripheral blood	1.44E-01	4.65E-01	8.08E-01
Multiple myeloma	2A83.1	Bone marrow	2.06E-05	7.94E-01	2.10E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	2.45E-01	1.05E+00	6.47E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	8.84E-02	4.60E-01	2.67E-01
Myelofibrosis	2A20.2	Whole blood	8.82E-01	9.93E-02	1.57E-01
Myocardial infarction	BA41-BA50	Peripheral blood	2.57E-03	2.24E+00	9.11E-01
Myopathy	8C70.6	Muscle tissue	1.90E-01	1.22E-01	8.33E-01
Neonatal sepsis	KA60	Whole blood	2.01E-04	2.50E-01	2.98E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	2.91E-03	-1.71E+00	-1.72E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	7.59E-01	-1.82E-01	-2.77E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	8.98E-01	2.34E-01	2.27E-01
Olive pollen allergy	CA08.00	Peripheral blood	1.33E-01	-2.69E+00	-1.13E+00
Oral cancer	2B6E	Oral tissue	2.57E-20	2.15E+00	3.06E+00
Osteoarthritis	FA00-FA0Z	Synovial tissue	3.32E-01	1.67E+00	7.39E-01
Osteoporosis	FB83.1	Bone marrow	1.11E-01	1.46E+00	2.30E+00
Ovarian cancer	2C73	Ovarian tissue	8.39E-01	-2.27E-01	-1.70E-01
Pancreatic cancer	2C10	Pancreas	4.99E-02	4.41E-01	3.23E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	2.40E-01	1.26E-01	5.45E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	9.76E-02	4.17E-01	3.93E-01
Pituitary cancer	2D12	Pituitary tissue	2.05E-01	9.35E-01	8.00E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	1.36E-01	1.73E+00	1.26E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	3.82E-01	7.25E-02	9.30E-01
Polycythemia vera	2A20.4	Whole blood	8.03E-04	2.57E-01	4.02E-01
Pompe disease	5C51.3	Biceps muscle	8.74E-01	-1.92E-01	-3.11E-01
Preterm birth	KA21.4Z	Myometrium	9.92E-02	-1.47E+00	-1.30E+00
Prostate cancer	2C82	Prostate	1.12E-01	-3.62E-01	-2.28E-01
Psoriasis	EA90	Skin	4.96E-01	3.15E-01	3.19E-01
Rectal cancer	2B92	Rectal colon tissue	2.03E-07	1.68E+00	3.86E+00
Renal cancer	2C90-2C91	Kidney	1.77E-01	3.04E-01	2.89E-01
Retinoblastoma	2D02.2	Uvea	3.15E-03	3.89E-01	3.17E+00
Rheumatoid arthritis	FA20	Synovial tissue	9.92E-06	1.36E+00	2.49E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	3.87E-01	2.30E-01	2.32E-01
Schizophrenia	6A20	Prefrontal cortex	8.68E-03	-3.36E-02	-4.78E-02
Schizophrenia	6A20	Superior temporal cortex	2.21E-01	1.15E-01	4.67E-01
Scleroderma	4A42.Z	Whole blood	2.73E-01	1.63E-01	9.41E-01
Seizure	8A60-8A6Z	Whole blood	3.18E-01	-4.21E-01	-3.76E-01
Sensitive skin	EK0Z	Skin	2.69E-02	3.69E-01	3.31E+00
Sepsis with septic shock	1G41	Whole blood	1.26E-05	-2.08E-01	-2.48E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	8.28E-01	2.24E-03	1.56E-03
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	1.81E-01	5.37E-02	5.83E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	2.94E-04	1.04E+00	1.01E+01
Sjogren's syndrome	4A43.2	Salivary gland tissue	7.08E-03	1.82E-01	2.12E+00
Skin cancer	2C30-2C3Z	Skin	2.41E-04	1.99E-01	2.40E-01
Thrombocythemia	3B63	Whole blood	2.32E-01	4.14E-01	6.58E-01
Thrombocytopenia	3B64	Whole blood	7.83E-01	2.92E-01	4.28E-01
Thyroid cancer	2D10	Thyroid	2.40E-04	5.50E-01	5.62E-01
Tibial muscular dystrophy	8C75	Muscle tissue	3.92E-01	7.80E-02	1.94E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	8.32E-01	-2.00E-02	-1.02E-01
Type 2 diabetes	5A11	Liver tissue	2.08E-01	1.68E-03	2.72E-02
Ureter cancer	2C92	Urothelium	3.49E-01	4.23E-02	2.33E-02
Uterine cancer	2C78	Endometrium tissue	2.74E-06	7.36E-01	5.02E-01
Vitiligo	ED63.0	Skin	1.60E-01	4.99E-01	5.73E-01
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

Prostaglandin G/H synthase 2 (COX-2) DTT Info

DME DTT Type

Successful

27 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aminosalicylic Acid	DMENSL5	Crohn disease	DD70	Approved	[1]
Carprofen	DMHMP05	Pain	MG30-MG3Z	Approved	[2]
Celecoxib	DM6LOQU	Dysmenorrhea	GA34.3	Approved	[3]
Diflunisal	DM7EN8I	Osteoarthritis	FA00-FA05	Approved	[4]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Hypertriglyceridemia	5C80.1	Approved	[5]
Etodolac	DM6WJO9	Osteoarthritis	FA00-FA05	Approved	[6]
Etoricoxib	DM6A4NW	Rheumatoid arthritis	FA20	Approved	[7]
FENBUFEN	DMXGDFK	Arthritis	FA20	Approved	[8]
Flufenamic Acid	DMC8VNH	Dysmenorrhea	GA34.3	Approved	[9]
Flurbiprofen	DMGN4BY	Osteoarthritis	FA00-FA05	Approved	[10]
Ibuprofen	DM8VCBE	Dysmenorrhea	GA34.3	Approved	[11]
Indomethacin	DMSC4A7	Bursitis		Approved	[1]
Ketoprofen	DMRKXPT	Bursitis		Approved	[12]
Lumiracoxib	DM1S4AG	Chronic renal failure	GB61.Z	Approved	[13]
Meclofenamate Sodium	DMNL98G	Arthritis	FA20	Approved	[14]
Mefenamic acid	DMK7HFI	Dysmenorrhea	GA34.3	Approved	[15]
Meloxicam	DM2AR7L	Arthritis	FA20	Approved	[16]
Nabumetone	DMAT2XH	Osteoarthritis	FA00-FA05	Approved	[17]
Naproxen	DMZ5RGV	Bursitis		Approved	[18]
Niflumic Acid	DMJ3I1Q	Rheumatoid arthritis	FA20	Approved	[19]
Phenylbutazone	DMAYL0T	Chronic pain	MG30	Approved	[20]
Rofecoxib	DM3P5DA	Osteoarthritis	FA00-FA05	Approved	[21]
Tenoxicam	DMVAZP9	Rheumatoid arthritis	FA20	Approved	[22]
Tiaprofenic acid	DM23D7J	Osteoarthritis	FA00-FA05	Approved	[23]
Tolmetin	DMWUIJE	Osteoarthritis	FA00-FA05	Approved	[11]
Valdecoxib	DMAY7H4	Osteoarthritis	FA00-FA05	Approved	[24]
IMRECOXIB	DMVXLOD	N. A.	N. A.	Phase 4	[25]
------------------------------------------------------------------------------------


⏷ Show the Full List of 27 Approved Drug(s)

10 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(S)-FLURBIPROFEN	DMF2O4T	Myalgia	FB56.2	Preregistration	[26]
CG-100649	DMIKMA9	Arthritis	FA20	Phase 3	[27]
Curcumin	DMQPH29	Solid tumour/cancer	2A00-2F9Z	Phase 3	[28]
ThermoProfen	DMPGH7N	Pain	MG30-MG3Z	Phase 3	[29]
Darbufelone	DMYVKM5	Asthma	CA23	Phase 2/3	[30]
CIMICOXIB	DMTKSVA	Pain	MG30-MG3Z	Phase 2	[31]
FK-3311	DML5AE4	Rheumatoid arthritis	FA20	Phase 2	[32]
SC-75416	DM58HR7	Pain	MG30-MG3Z	Phase 2	[33]
CA102N	DMYDNQ2	Solid tumour/cancer	2A00-2F9Z	Phase 1	[34]
RWJ-67657	DM6YAGE	Arthritis	FA20	Phase 1	[35]
------------------------------------------------------------------------------------


⏷ Show the Full List of 10 Clinical Trial Drug(s)

2 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Carbamate derivative 2	DMEWPQ6	N. A.	N. A.	Patented	[36]
PMID29130358-Compound-LonimacranthoideVI	DMTJEU5	N. A.	N. A.	Patented	[37]
------------------------------------------------------------------------------------

32 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
INDOPROFEN	DM5QSKN	Gout	FA25	Withdrawn from market	[26]
GW-406381	DMJ4KQS	Neuropathic pain	8E43.0	Discontinued in Phase 3	[38]
PMI-001	DMDZBIQ	Lupus	4A40	Discontinued in Phase 3	[39]
PRINOMIDE TROMETHAMINE	DMI02PF	Inflammation	1A00-CA43.1	Discontinued in Phase 3	[40]
Apricoxib	DMR3Q82	Non-small-cell lung cancer	2C25.Y	Discontinued in Phase 2	[41]
CRx-401	DM39N7W	Type-2 diabetes	5A11	Discontinued in Phase 2	[42]
GSK-644784	DMUC9OS	Neuropathic pain	8E43.0	Discontinued in Phase 2	[38]
R-ketoprofen	DMHSUQ1	N. A.	N. A.	Discontinued in Phase 2	[26]
RQ-00317076	DM4GVZ9	Pain	MG30-MG3Z	Discontinued in Phase 2	[43]
S-2474	DMMSZ1A	Rheumatoid arthritis	FA20	Discontinued in Phase 2	[44]
TEBUFELONE	DMMUE8P	Pain	MG30-MG3Z	Discontinued in Phase 2	[45]
Tilmacoxib	DMPWSRA	Colon polyp	DB35	Discontinued in Phase 2	[46]
DUP 697	DMUMAHC	Pain	MG30-MG3Z	Discontinued in Phase 1	[47]
E-6087	DM79MI4	Pain	MG30-MG3Z	Discontinued in Phase 1	[48]
GR-253035	DMWY2F6	Alzheimer disease	8A20	Discontinued in Phase 1	[49]
SC-57666	DMIVRWS	Rheumatoid arthritis	FA20	Discontinued in Phase 1	[45]
ATLIPROFEN METHYL ESTER	DMS2FB3	Inflammation	1A00-CA43.1	Terminated	[1]
Flosulide	DM6OIJ1	Pain	MG30-MG3Z	Terminated	[50]
FR-123826	DM0582D	Rheumatoid arthritis	FA20	Terminated	[51]
L-745337	DMOQIWH	Asthma	CA23	Terminated	[52]
L-768277	DM7J6QH	Hyperthermia	MG26	Terminated	[53]
Nimesulide	DMR1NMD	Metastatic colorectal cancer	2B91	Terminated	[54]
NMI-150	DMX6DNZ	Pain	MG30-MG3Z	Terminated	[55]
NS398	DMINUWH	Endometriosis	GA10	Terminated	[56]
ON-09300	DMMLXRG	Solid tumour/cancer	2A00-2F9Z	Terminated	[1]
RPR 200765A	DM1U0TB	Rheumatoid arthritis	FA20	Terminated	[57]
RWJ-63556	DMUDE1T	Arthritis	FA20	Terminated	[58]
S-33516	DMF710M	Arthritis	FA20	Terminated	[59]
SB 203580	DMAET6F	N. A.	N. A.	Terminated	[60]
SC-236	DMO1URE	Solid tumour/cancer	2A00-2F9Z	Terminated	[61]
SC-58125	DM874YU	N. A.	N. A.	Terminated	[62]
SC-58451	DMVGK24	N. A.	N. A.	Terminated	[63]
------------------------------------------------------------------------------------


⏷ Show the Full List of 32 Discontinued Drug(s)

126 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(11H-Dibenzo[b,e][1,4]dioxepin-2-yl)-acetic acid	DMSUPVE	Discovery agent	N.A.	Investigative	[64]
(11H-Dibenzo[b,e][1,4]dioxepin-7-yl)-acetic acid	DM5ZTXL	Discovery agent	N.A.	Investigative	[64]
(11H-Dibenzo[b,e][1,4]dioxepin-8-yl)-acetic acid	DMBY623	Discovery agent	N.A.	Investigative	[64]
(E)-2-(4-(methylsulfonyl)styryl)furan	DMH2U4Z	Discovery agent	N.A.	Investigative	[65]
(E)-2-(4-(methylsulfonyl)styryl)thiophene	DMDFE1R	Discovery agent	N.A.	Investigative	[65]
(E)-3-(4-(methylsulfonyl)styryl)thiophene	DMUS0D8	Discovery agent	N.A.	Investigative	[65]
(E)-4-(2-(furan-2-yl)vinyl)benzenesulfonamide	DMDF7M4	Discovery agent	N.A.	Investigative	[65]
(E)-4-(2-(thiophen-2-yl)vinyl)benzenesulfonamide	DM7204O	Discovery agent	N.A.	Investigative	[65]
(E)-4-(2-(thiophen-3-yl)vinyl)benzenesulfonamide	DMTAB8W	Discovery agent	N.A.	Investigative	[65]
(R)-2-(4-Isobutyl-phenyl)-N-phenyl-propionamide	DMAD4JY	Discovery agent	N.A.	Investigative	[26]
(Z)-2'-des-methyl sulindac sulfide	DM0OEQJ	Discovery agent	N.A.	Investigative	[66]
1,2-dihydro-3-(2,3,4-trimethoxyphenyl)naphthalene	DMST60D	Discovery agent	N.A.	Investigative	[67]
1,3-bis(nitrooxy)propan-2-yl 2-acetoxybenzoate	DMIK7XV	Discovery agent	N.A.	Investigative	[68]
1-(2-hydroxyphenyl)-3-p-tolylprop-2-en-1-one	DMAFS7J	Discovery agent	N.A.	Investigative	[69]
1-(4-(methylsulfonyl)phenyl)-1H-indole	DMCE7G0	Discovery agent	N.A.	Investigative	[70]
1-(4-(methylsulfonyl)phenyl)-1H-pyrrole	DMYFBRQ	Discovery agent	N.A.	Investigative	[70]
1-(4-(methylsulfonyl)phenyl)-3-p-tolylurea	DMMSQLC	Discovery agent	N.A.	Investigative	[71]
1-(4-(methylsulfonyl)phenyl)-3-phenylurea	DMH7RY0	Discovery agent	N.A.	Investigative	[71]
1-(4-aminosulfonylphenyl)-2-(2-pyridyl)acetylene	DMWA6G1	Discovery agent	N.A.	Investigative	[72]
2'-hydroxy-3,4,5-trimethoxychalcone	DM5ACNU	Discovery agent	N.A.	Investigative	[69]
2'-Hydroxychalcone	DM8RTBS	Discovery agent	N.A.	Investigative	[69]
2,3-dimethoxy-2'-hydroxychalcone	DML92OK	Discovery agent	N.A.	Investigative	[69]
2,4'-Dimethoxy-5,3'-di-(2-propenyl)-biphenyl	DMWNJ84	Discovery agent	N.A.	Investigative	[73]
2,4'-Dimethoxy-5,3'-dipropyl-biphenyl	DM94NM7	Discovery agent	N.A.	Investigative	[73]
2,4-dimethoxy-2'-hydroxychalcone	DMP9BZU	Discovery agent	N.A.	Investigative	[69]
2,6-dihydroxy-1,7-dimethoxyxanthone	DM5QEUC	Discovery agent	N.A.	Investigative	[74]
2-(2,3,4-trimethoxyphenyl)-1H-indene	DMFU1PK	Discovery agent	N.A.	Investigative	[67]
2-(2-(2,6-dimethylphenylamino)phenyl)acetic acid	DMJ2DE4	Discovery agent	N.A.	Investigative	[75]
2-(3-Phenyl-propyl)-1,2-dihydro-indazol-3-one	DMIQBXD	Discovery agent	N.A.	Investigative	[76]
2-(4-(methylsulfonyl)phenyl)-3-phenylquinoline	DMVD6HE	Discovery agent	N.A.	Investigative	[77]
2-(4-(methylsulfonyl)phenyl)pyridine	DM1TZNK	Discovery agent	N.A.	Investigative	[70]
2-(N-(2-Ffuorophenyl)pyrrol-3-yl) acetic acid	DMRNOM6	Discovery agent	N.A.	Investigative	[78]
2-(N-(2-fluorophenyl)pyrrol-2-yl) acetic acid	DMCL9E6	Discovery agent	N.A.	Investigative	[78]
2-(p-Methylsulfonylbenzoyl)furan	DMLT635	Discovery agent	N.A.	Investigative	[70]
2-Benzyl-1,2-dihydro-indazol-3-one	DM1CB5J	Discovery agent	N.A.	Investigative	[76]
2-Furan-2-ylmethyl-1,2-dihydro-indazol-3-one	DMQIRY7	Discovery agent	N.A.	Investigative	[76]
2-Methyl-1,2-dihydro-indazol-3-one	DMDJHFQ	Discovery agent	N.A.	Investigative	[76]
2-Naphthalen-2-ylmethyl-1,2-dihydro-indazol-3-one	DM1EJ6W	Discovery agent	N.A.	Investigative	[76]
2-Phenethyl-1,2-dihydro-indazol-3-one	DM0WMBC	Discovery agent	N.A.	Investigative	[76]
2-Phenyl-1,2-dihydro-indazol-3-one	DM28CLZ	Discovery agent	N.A.	Investigative	[76]
3 beta-O-acetyloleanolic acid	DM1L5IJ	Discovery agent	N.A.	Investigative	[79]
3,4-dibenzyloxy-2'-hydroxychalcone	DMBUT8A	Discovery agent	N.A.	Investigative	[69]
3,4-dihydroxyxanthone	DMTQX92	Discovery agent	N.A.	Investigative	[74]
3-(4-Methanesulfonyl-phenyl)-1-phenyl-propynone	DMSR2O3	Discovery agent	N.A.	Investigative	[80]
3-benzyloxy-4-methoxy-2'-hydroxychalcone	DMKD874	Discovery agent	N.A.	Investigative	[69]
3-Bromo-2'-hydroxy-4-methoxychalcone	DM1BALV	Discovery agent	N.A.	Investigative	[69]
4,5-Bis(4-chlorophenyl)-1,2-selenazole	DMIO254	Discovery agent	N.A.	Investigative	[81]
4,5-Bis(4-chlorophenyl)isothiazole	DMENLFY	Discovery agent	N.A.	Investigative	[82]
4,5-Bis(4-methoxyphenyl)-1,2-selenazole	DMKHD1M	Discovery agent	N.A.	Investigative	[81]
4,5-Bis(4-methoxyphenyl)-3H-1,2-dithiol-3-one	DMI39QT	Discovery agent	N.A.	Investigative	[82]
4,5-Bis(4-methoxyphenyl)isothiazole	DM90DV6	Discovery agent	N.A.	Investigative	[82]
4-((4-methoxyphenyl)diazenyl)benzenesulfonamide	DMNAT1D	Discovery agent	N.A.	Investigative	[83]
4-(3-hydroxy-benzylideneamino)-benzenesulfonamide	DMY2OVL	Discovery agent	N.A.	Investigative	[84]
4-(3-methoxy-benzylideneamino)-benzenesulfonamide	DMO8SQA	Discovery agent	N.A.	Investigative	[84]
4-(3-nitro-benzylideneamino)-benzenesulfonamide	DMD94OB	Discovery agent	N.A.	Investigative	[84]
4-(4-Chlorophenyl)-5-p-tolyl-1,2-selenazole	DMZBEYO	Discovery agent	N.A.	Investigative	[81]
4-(4-fluoro-benzylideneamino)-benzenesulfonamide	DMRJD75	Discovery agent	N.A.	Investigative	[84]
4-(4-fluoro-phenyliminomethyl)-benzenesulfonamide	DMK8DCF	Discovery agent	N.A.	Investigative	[84]
4-(4-hydroxy-benzylideneamino)-benzenesulfonamide	DMNY0I5	Discovery agent	N.A.	Investigative	[84]
4-(4-methoxy-benzylideneamino)-benzenesulfonamide	DM2OR8E	Discovery agent	N.A.	Investigative	[84]
4-(4-methyl-benzylideneamino)-benzenesulfonamide	DMZSQ04	Discovery agent	N.A.	Investigative	[84]
4-(4-methyl-phenyliminomethyl)-benzenesulfonamide	DMV0S4U	Discovery agent	N.A.	Investigative	[84]
4-(4-nitro-benzylideneamino)-benzenesulfonamide	DMM86YK	Discovery agent	N.A.	Investigative	[84]
4-(benzylideneamino)benzenesulfonamide	DM03BQD	Discovery agent	N.A.	Investigative	[84]
4-amino-N-(4-chlorophenyl)benzenesulfonamide	DMCUSD4	Discovery agent	N.A.	Investigative	[85]
4-amino-N-(4-iodophenyl)benzenesulfonamide	DMN19QP	Discovery agent	N.A.	Investigative	[85]
4-benzyloxy-2'-hydroxychalcone	DMDC7TL	Discovery agent	N.A.	Investigative	[69]
4-fluoro-N-(4-(methylsulfonyl)phenyl)aniline	DMV6M5U	Discovery agent	N.A.	Investigative	[70]
4-phenyliminomethyl-benzenesulfonamide	DM9J5TZ	Discovery agent	N.A.	Investigative	[84]
5,3'-Dipropyl-biphenyl-2,4'-diol	DMJRXLD	Discovery agent	N.A.	Investigative	[73]
5-(2-Imidazol-1-yl-ethyl)-7,8-dihydro-quinoline	DMCP5U8	Discovery agent	N.A.	Investigative	[86]
5-(4-Chlorophenyl)-4-p-tolyl-1,2-selenazole	DMY0P86	Discovery agent	N.A.	Investigative	[81]
5-(4-Methoxyphenyl)-4-p-tolyl-1,2-selenazole	DMEV8WS	Discovery agent	N.A.	Investigative	[81]
5-Ethyl-3,4-diphenyl-isoxazole	DMRIGXA	Discovery agent	N.A.	Investigative	[87]
5-methoxy-2-(4-(methylsulfonyl)phenyl)-1H-indole	DMG2HSU	Discovery agent	N.A.	Investigative	[88]
5-Methyl-3,4-diphenyl-isoxazole	DM0G2N5	Discovery agent	N.A.	Investigative	[87]
5-Phenyl-pentanoic acid benzyl-hydroxy-amide	DM3B6A8	Discovery agent	N.A.	Investigative	[89]
5-thia-8,11,14,17-eicosatetraenoic acid	DMF4RGW	Discovery agent	N.A.	Investigative	[5]
6,7'-oxybis(2-phenyl-4H-chromen-4-one)	DMT09YC	Discovery agent	N.A.	Investigative	[90]
8alpha,19-dihydroxylabd-13 E-en-15-oic acid	DM7K2DN	Discovery agent	N.A.	Investigative	[91]
alpha-linolenic acid	DMY64HE	Discovery agent	N.A.	Investigative	[5]
B-Octylglucoside	DMMO75G	Discovery agent	N.A.	Investigative	[92]
Bimetopyrole	DMPR14J	Pain	MG30-MG3Z	Investigative	[47]
C-myb	DMA5Z2G	Pain	MG30-MG3Z	Investigative	[93]
CLEMATOMANDSHURICA SAPONIN A	DM4SKYA	Discovery agent	N.A.	Investigative	[94]
CLEMATOMANDSHURICA SAPONIN B	DMNWXOC	Discovery agent	N.A.	Investigative	[94]
CR-4174	DM3M5AW	Inflammation	1A00-CA43.1	Investigative	[95]
CX-9051	DM526C9	Solid tumour/cancer	2A00-2F9Z	Investigative	[95]
DFU	DMUM84K	Pain	MG30-MG3Z	Investigative	[96]
Firocoxib	DMP6GNY	Discovery agent	N.A.	Investigative	[97]
Fluoro loxoprofen	DMJS62X	Discovery agent	N.A.	Investigative	[98]
Furan-3-yl(4-(methylsulfonyl)phenyl)methanone	DMPC6YL	Discovery agent	N.A.	Investigative	[70]
GW-637185X	DMX59A0	Discovery agent	N.A.	Investigative	[99]
Heme	DMGC287	Discovery agent	N.A.	Investigative	[100]
HONOKIOL	DMJWT3X	Discovery agent	N.A.	Investigative	[73]
L-748780	DMJZXAF	Discovery agent	N.A.	Investigative	[101]
L-761000	DM0A2MG	Discovery agent	N.A.	Investigative	[101]
LM-4108	DMWLMTD	Discovery agent	N.A.	Investigative	[102]
METHYLHONOKIOL	DM9YE6K	Discovery agent	N.A.	Investigative	[73]
Microxine	DM7Y9AD	Pain	MG30-MG3Z	Investigative	[103]
N-(1H-indazol-5-yl)acetamide	DMIMJNU	Discovery agent	N.A.	Investigative	[104]
N-(3-(phenylthio)pyridin-4-yl)methanesulfonamide	DMSJX1H	Discovery agent	N.A.	Investigative	[105]
N-(3-phenoxy-4-pyridinyl)ethanesulfonamide	DMXF46V	Discovery agent	N.A.	Investigative	[106]
N-(3-phenylamino-4-pyridinyl)methanesulfonamide	DMJB7SE	Discovery agent	N.A.	Investigative	[105]
Nectamazin C	DMO0Q1F	Discovery agent	N.A.	Investigative	[107]
NEOLIGNAN 9-NOR-7,8-DEHYDRO-ISOLICARIN B	DMKFPA9	Discovery agent	N.A.	Investigative	[107]
Nitroflurbiprofen	DMWCV48	Discovery agent	N.A.	Investigative	[108]
NSC-27236	DMANZIE	Discovery agent	N.A.	Investigative	[83]
OCOPHYLLALS A	DMT59UG	Discovery agent	N.A.	Investigative	[107]
Ocophyllals b	DMEUPVF	Discovery agent	N.A.	Investigative	[107]
Oxametacin	DMWVLG1	Discovery agent	N.A.	Investigative	[109]
Oxindole 94	DMPFD6Y	Pain	MG30-MG3Z	Investigative	[110]
PAC-10649	DMKL6IC	Arthritis	FA20	Investigative	[111]
PHENIDONE	DMJD8XN	Discovery agent	N.A.	Investigative	[76]
Prifelone	DMLI4RF	Discovery agent	N.A.	Investigative	[112]
Primary alcohol metabolite of celecoxib	DMA8GI6	Discovery agent	N.A.	Investigative	[113]
Prostaglandin G2	DME74SP	Discovery agent	N.A.	Investigative	[100]
Resveratrol Potassium3-Sulfate	DMN1RLA	Discovery agent	N.A.	Investigative	[114]
Resveratrol Potassium4,-Sulfate	DMMFP57	Discovery agent	N.A.	Investigative	[114]
SB 239063	DM201Q7	Pain	MG30-MG3Z	Investigative	[115]
SC-558	DMAZLKX	Discovery agent	N.A.	Investigative	[116]
Silicon-modified indomethacin	DM5ZILV	Arthritis	FA20	Investigative	[95]
TENOSAL	DMMLSZ4	Rheumatoid arthritis	FA20	Investigative	[117]
THIOCTIC ACID	DMNFCXW	Discovery agent	N.A.	Investigative	[81]
Wogonin	DMGCF51	Discovery agent	N.A.	Investigative	[69]
XGP-110	DM96FTS	Arthritis	FA20	Investigative	[95]
------------------------------------------------------------------------------------


⏷ Show the Full List of 126 Investigative Drug(s)

References

1	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
2	Scaffold of the cyclooxygenase-2 (COX-2) inhibitor carprofen provides Alzheimer gamma-secretase modulators. J Med Chem. 2006 Dec 28;49(26):7588-91.
3	Pfizer. Product Development Pipeline. March 31 2009.
4	Celecoxib and rofecoxib. The role of COX-2 inhibitors in dental practice. J Am Dent Assoc. 2001 Apr;132(4):451-6.
5	Cox-2 inhibitory effects of naturally occurring and modified fatty acids. J Nat Prod. 2001 Jun;64(6):745-9.
6	Membranous nephropathy associated with the relatively selective cyclooxygenase-2 inhibitor, etodolac, in a patient with early rheumatoid arthritis. Intern Med. 2007;46(13):1055-8.
7	The effect of newer anti-rheumatic drugs on osteogenic cell proliferation: an in-vitro study. J Orthop Surg Res. 2009 May 26;4:17.
8	Fenbufen based 3-[5-(substituted aryl)-1,3,4-oxadiazol-2-yl]-1-(biphenyl-4-yl)propan-1-ones as safer antiinflammatory and analgesic agents. Eur J Med Chem. 2009 Sep;44(9):3798-804.
9	Ouellet M, Percival MD: Effect of inhibitor time-dependency on selectivity towards cyclooxygenase isoforms. Biochem J. 1995 Feb 15;306 ( Pt 1):247-51.
10	Flurbiprofen, a cyclooxygenase inhibitor, protects mice from hepatic ischemia/reperfusion injury by inhibiting GSK-3 signaling and mitochondrial permeability transition.Mol Med.2012 Sep 25;18:1128-35.
11	Maternal toxicity of nonsteroidal anti-inflammatory drugs as an important factor affecting prenatal development. Reprod Toxicol. 2009 Sep;28(2):239-44.
12	Probing the skin permeation of fish oil/EPA and ketoprofen-3. Effects on epidermal COX-2 and LOX. Prostaglandins Leukot Essent Fatty Acids. 2007 Jun;76(6):357-62.
13	Dissociation of airway inflammation and hyperresponsiveness by cyclooxygenase inhibition in allergen challenged mice. Eur Respir J. 2009 Jul;34(1):200-8.
14	Role of COX-2-derived metabolites in regulation of the renal hemodynamic response to norepinephrine. Am J Physiol Renal Physiol. 2001 Nov;281(5):F975-82.
15	Systematic pharmacological approach to the characterization of NSAIDs. Prostaglandins Leukot Essent Fatty Acids. 1998 Jul;59(1):55-62.
16	Meloxicam: selective COX-2 inhibition in clinical practice. Semin Arthritis Rheum. 1997 Jun;26(6 Suppl 1):21-7.
17	Renal effects of nabumetone, a COX-2 antagonist: impairment of function in isolated perfused rat kidneys contrasts with preserved renal function in vivo. Exp Nephrol. 2001;9(6):387-96.
18	Comparative inhibitory activity of rofecoxib, meloxicam, diclofenac, ibuprofen, and naproxen on COX-2 versus COX-1 in healthy volunteers. J Clin Pharmacol. 2000 Oct;40(10):1109-20.
19	Rat ovulation, implantation and decidualization are severely compromised by COX-2 inhibitors. Front Biosci. 2007 May 1;12:3333-42.
20	COX-1 and COX-2 inhibition in horse blood by phenylbutazone, flunixin, carprofen and meloxicam: an in vitro analysis. Pharmacol Res. 2005 Oct;52(4):302-6.
21	Privileged structures: a useful concept for the rational design of new lead drug candidates. Mini Rev Med Chem. 2007 Nov;7(11):1108-19.
22	The use and safety profile of non-steroidal antiinflammatory drugs among Turkish patients with osteoarthritis. Turk J Gastroenterol. 2005 Sep;16(3):138-42.
23	Effects of tiaprofenic acid on the concentration and metabolism of proteoglycans in normal and degenerating canine articular cartilage. J Clin Pharmacol. 1990 Sep;30(9):808-14.
24	Biochemical mechanisms of New Molecular Entities (NMEs) approved by United States FDA during 2001-2004: mechanisms leading to optimal efficacy and ... Curr Top Med Chem. 2006;6(5):461-78.
25	Synthesis and anti-inflammatory activity of the major metabolites of imrecoxib. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2270-2.
26	2-Arylpropionic CXC chemokine receptor 1 (CXCR1) ligands as novel noncompetitive CXCL8 inhibitors. J Med Chem. 2005 Jun 30;48(13):4312-31.
27	Pharmacokinetic, pharmacodynamic, and safety/tolerability profiles of CG100649, a novel COX-2 inhibitor: results of a phase i, randomized, multiple-dose study in healthy Korean men and women. Clin Ther. 2015 Jan 1;37(1):197-210.
28	Design, synthesis, biological evaluation and molecular docking of curcumin analogues as antioxidant, cyclooxygenase inhibitory and anti-inflammator... Bioorg Med Chem Lett. 2005 Apr 1;15(7):1793-7.
29	Topical NSAID therapy for musculoskeletal pain. Pain Med. 2010 Apr;11(4):535-49.
30	Novel dual cyclooxygenase and lipoxygenase inhibitors targeting hyaluronan-CD44v6 pathway and inducing cytotoxicity in colon cancer cells. Bioorg Med Chem. 2013 May 1;21(9):2551-9.
31	Pharmacokinetic profiles of the novel COX-2 selective inhibitor cimicoxib in dogs.Vet J.2014 Apr;200(1):77-81.
32	Effects of the COX-2 inhibitor FK3311 on ischemia - reperfusion injury in the rat lung. J Invest Surg. 2007 May-Jun;20(3):175-80.
33	Modeling and simulation to support dose selection and clinical development of SC-75416, a selective COX-2 inhibitor for the treatment of acute and ... Clin Pharmacol Ther. 2008 Jun;83(6):857-66.
34	National Cancer Institute Drug Dictionary (drug name CA102N).
35	Monocyte intracellular cytokine production during human endotoxaemia with or without a second in vitro LPS challenge: effect of RWJ-67657, a p38 MAP-kinase inhibitor, on LPS-hyporesponsiveness. Clin Exp Immunol. 2002 Feb;127(2):337-43.
36	Fatty acid amide hydrolase inhibitors: a patent review (2009-2014).Expert Opin Ther Pat. 2015;25(11):1247-66.
37	Gelatinase inhibitors: a patent review (2011-2017).Expert Opin Ther Pat. 2018 Jan;28(1):31-46.
38	Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
39	Development of a botanical anti-arthritis drug, PMI-001. SBIR.STTR America's Seed Fund.
40	Dexketoprofene, selective cox-1 inhibitor nsaids, without gastrointestinal injury in rats. Acta Gastroenterol Latinoam. 2002 May;32(1):17-20.
41	Apricoxib, a COX-2 inhibitor for the potential treatment of pain and cancer. IDrugs. 2009 Nov;12(11):711-22.
42	ClinicalTrials.gov (NCT00506298) Study of CRx-401 on Glucose Levels in Subjects With Type II Diabetes. U.S. National Institutes of Health.
43	Clinical pipeline report, company report or official report of raqualia.
44	Effects of S-2474, a novel nonsteroidal anti-inflammatory drug, on amyloid beta protein-induced neuronal cell death. Br J Pharmacol. 2001 Oct;134(3):673-81.
45	New cyclooxygenase-2/5-lipoxygenase inhibitors. 2. 7-tert-butyl-2,3-dihydro-3,3-dimethylbenzofuran derivatives as gastrointestinal safe antiinflamm... J Med Chem. 1998 Mar 26;41(7):1124-37.
46	4-(4-cycloalkyl/aryl-oxazol-5-yl)benzenesulfonamides as selective cyclooxygenase-2 inhibitors: enhancement of the selectivity by introduction of a ... J Med Chem. 2002 Mar 28;45(7):1511-7.
47	Current status of COX-2 inhibitors. Mini Rev Med Chem. 2008 Jan;8(1):73-90.
48	Enantioselective HPLC determination of E-6087, a new COX-2 inhibitor, in human plasma: Validation and pharmacokinetic application. Chirality. 2004 May 15;16(5):302-8.
49	Role of cyclooxygenases 1 and 2 in the modulation of neuromuscular functions in the distal colon of humans and mice. Gut. 2005 May; 54(5): 608-616.
50	Effect of flosulide, a selective cyclooxygenase 2 inhibitor, on passive heymann nephritis in the rat. Kidney Int. 1999 Nov;56(5):1770-8.
51	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007983)
52	Pharmacology of a selective cyclooxygenase-2 inhibitor, L-745,337: a novel nonsteroidal anti-inflammatory agent with an ulcerogenic sparing effect ... J Pharmacol Exp Ther. 1995 Sep;274(3):1531-7.
53	Characterization of the in vitro oxidative metabolites of the COX-2 selective inhibitor L-766,112. Bioorganic & Medicinal Chemistry Letters Volume 7, Issue 1, 7 January 1997, Pages 53-56.
54	Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5.
55	Selective COX-2 Inhibitors: A Review of Their Structure-Activity Relationships. Iran J Pharm Res. 2011 Autumn; 10(4): 655-683.
56	New drugs in development for the treatment of endometriosis. Expert Opin Investig Drugs. 2008 Aug;17(8):1187-202.
57	The discovery of RPR 200765A, a p38 MAP kinase inhibitor displaying a good oral anti-arthritic efficacy. Bioorg Med Chem. 2001 Feb;9(2):537-54.
58	Evaluation of the antiinflammatory activity of a dual cyclooxygenase-2 selective/5-lipoxygenase inhibitor, RWJ 63556, in a canine model of inflammation. J Pharmacol Exp Ther. 1997 Aug;282(2):1094-101.
59	S 33516 Servier preclinical data. R & D Focus Drug News. July 12, 1999.
60	Inhibition of p38 MAP kinase as a therapeutic strategy. Immunopharmacology. 2000 May;47(2-3):185-201.
61	Cyclooxygenase (COX)-2-dependent effects of the inhibitor SC236 when combined with ionizing radiation in mammary tumor cells derived from HER-2/neu mice. Mol Cancer Ther. 2004 Apr;3(4):417-24.
62	Identification and optimisation of a novel series of pyrimidine based cyclooxygenase-2 (COX-2) inhibitors. Utilisation of a biotransformation appro... Bioorg Med Chem Lett. 2009 Aug 1;19(15):4509-14.
63	Novel 1,2-diarylcyclobutenes: Selective and orally active cox-2 inhibitors, Bioorg. Med. Chem. Lett. 6(22):2677-2682 (1996).
64	Synthesis and antiinflammatory/analgesic activities of 11H-dibenzo[b, e,][1,4]dioxepinacetic acids. J Med Chem. 1986 Aug;29(8):1436-41.
65	Sulfonamide derivatives of styrylheterocycles as a potent inhibitor of COX-2-mediated prostaglandin E2 production. Bioorg Med Chem Lett. 2010 Dec 1;20(23):6938-41.
66	The influence of double bond geometry in the inhibition of cyclooxygenases by sulindac derivatives. Bioorg Med Chem Lett. 2009 Jun 15;19(12):3271-4.
67	'Bridged' stilbene derivatives as selective cyclooxygenase-1 inhibitors. Bioorg Med Chem. 2007 Sep 15;15(18):6109-18.
68	Dinitroglyceryl and diazen-1-ium-1,2-diolated nitric oxide donor ester prodrugs of aspirin, indomethacin and ibuprofen: synthesis, biological evalu... Bioorg Med Chem Lett. 2009 Jun 1;19(11):3014-8.
69	Inhibitory activity of prostaglandin E2 production by the synthetic 2'-hydroxychalcone analogues: Synthesis and SAR study. Bioorg Med Chem Lett. 2009 Mar 15;19(6):1650-3.
70	Synthesis, anti-inflammatory activity, and in vitro antitumor effect of a novel class of cyclooxygenase inhibitors: 4-(aryloyl)phenyl methyl sulfones. J Med Chem. 2010 Sep 23;53(18):6560-71.
71	Design and synthesis of 1,3-diarylurea derivatives as selective cyclooxygenase (COX-2) inhibitors. Bioorg Med Chem Lett. 2008 Feb 15;18(4):1336-9.
72	Synthesis and cyclooxygenase inhibitory activities of linear 1-(methanesulfonylphenyl or benzenesulfonamido)-2-(pyridyl)acetylene regioisomers. Bioorg Med Chem. 2008 Feb 15;16(4):1948-56.
73	Design and synthesis of ten biphenyl-neolignan derivatives and their in vitro inhibitory potency against cyclooxygenase-1/2 activity and 5-lipoxyge... Bioorg Med Chem. 2009 Jul 1;17(13):4459-65.
74	Selective cyclooxygenase-2 inhibitors from Calophyllum membranaceum. J Nat Prod. 2005 Oct;68(10):1514-8.
75	Molecular determinants for the selective inhibition of cyclooxygenase-2 by lumiracoxib. J Biol Chem. 2007 Jun 1;282(22):16379-90.
76	Indazolinones, a new series of redox-active 5-lipoxygenase inhibitors with built-in selectivity and oral activity. J Med Chem. 1991 Mar;34(3):1028-36.
77	Design, synthesis and biological evaluation of new 2,3-diarylquinoline derivatives as selective cyclooxygenase-2 inhibitors. Bioorg Med Chem. 2010 Feb;18(3):1029-33.
78	Synthesis and biological activity of new anti-inflammatory compounds containing the 1,4-benzodioxine and/or pyrrole system. Bioorg Med Chem. 2007 Jul 15;15(14):4876-90.
79	Nitrogen-containing phorbol esters from Croton ciliatoglandulifer and their effects on cyclooxygenases-1 and -2. J Nat Prod. 2006 Jun;69(6):887-90.
80	Synthesis and biological evaluation of 1,3-diphenylprop-2-yn-1-ones as dual inhibitors of cyclooxygenases and lipoxygenases. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4842-5.
81	Investigations concerning the COX/5-LOX inhibiting and hydroxyl radical scavenging potencies of novel 4,5-diaryl isoselenazoles. Eur J Med Chem. 2008 Jun;43(6):1152-9.
82	Diaryl-dithiolanes and -isothiazoles: COX-1/COX-2 and 5-LOX-inhibitory, *OH scavenging and anti-adhesive activities. Bioorg Med Chem. 2009 Jan 15;17(2):558-68.
83	Selective COX-2 inhibitors. Part 1: synthesis and biological evaluation of phenylazobenzenesulfonamides. Bioorg Med Chem Lett. 2006 Sep 1;16(17):4440-3.
84	Selective COX-2 inhibitors. Part 2: synthesis and biological evaluation of 4-benzylideneamino- and 4-phenyliminomethyl-benzenesulfonamides. Bioorg Med Chem. 2008 Mar 1;16(5):2697-706.
85	Analgesic agents without gastric damage: design and synthesis of structurally simple benzenesulfonanilide-type cyclooxygenase-1-selective inhibitors. Bioorg Med Chem. 2007 Jan 15;15(2):1014-21.
86	1-imidazolyl(alkyl)-substituted di- and tetrahydroquinolines and analogues: syntheses and evaluation of dual inhibitors of thromboxane A(2) synthas... J Med Chem. 2000 May 4;43(9):1841-51.
87	Novel synthesis of 3,4-diarylisoxazole analogues of valdecoxib: reversal cyclooxygenase-2 selectivity by sulfonamide group removal. J Med Chem. 2004 Sep 23;47(20):4881-90.
88	Synthesis and biological evaluation of new 4-carboxyl quinoline derivatives as cyclooxygenase-2 inhibitors. Bioorg Med Chem. 2009 Jul 15;17(14):5312-7.
89	Differential effects of a series of hydroxamic acid derivatives on 5-lipoxygenase and cyclooxygenase from neutrophils and 12-lipoxygenase from plat... J Med Chem. 1989 Aug;32(8):1836-42.
90	Synthesis of biflavones having a 6-O-7'' linkage and effects on cyclooxygenase-2 and inducible nitric oxide synthase. Bioorg Med Chem Lett. 2009 Jan 1;19(1):74-6.
91	Cyclooxygenase (COX)-1 and -2 inhibitory labdane diterpenes from Crassocephalum mannii. J Nat Prod. 2008 Jun;71(6):1070-3.
92	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
93	Cyclooxygenase-2, a colorectal cancer nonsteroidal anti-inflammatory drug target, is regulated by c-MYB. Cancer Res. 2000 Apr 1;60(7):1805-9.
94	Triterpene saponins from clematis mandshurica. J Nat Prod. 2006 Nov;69(11):1591-5.
95	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1376).
96	Inhibition of cyclooxygenase-2 improves cardiac function in myocardial infarction. Biochem Biophys Res Commun. 2000 Jul 5;273(2):772-5.
97	SAR in the alkoxy lactone series: the discovery of DFP, a potent and orally active COX-2 inhibitor. Bioorg Med Chem Lett. 1999 Aug 2;9(15):2207-12.
98	Properties and synthesis of 2-{2-fluoro (or bromo)-4-[(2-oxocyclopentyl)methyl]phenyl}propanoic acid: nonsteroidal anti-inflammatory drugs with low... J Med Chem. 2010 Nov 11;53(21):7879-82.
99	Identification of [4-[4-(methylsulfonyl)phenyl]-6-(trifluoromethyl)-2-pyrimidinyl] amines and ethers as potent and selective cyclooxygenase-2 inhib... Bioorg Med Chem Lett. 2009 Aug 1;19(15):4504-8.
100	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
101	From indomethacin to a selective COX-2 inhibitor: Development of indolalkanoic acids as potent and selective cyclooxygenase-2 inhibitors, Bioorg. Med. Chem. Lett. 6(6):725-730 (1996).
102	Discovery of 3-(4-bromophenyl)-6-nitrobenzo[1.3.2]dithiazolium ylide 1,1-dioxide as a novel dual cyclooxygenase/5-lipoxygenase inhibitor that also ... Bioorg Med Chem. 2010 Jan 15;18(2):597-604.
103	Inhibition of cell cycle oscillation of DNA replication by a selective inhibitor of the cdc2 kinase family, butyrolactone I, in Xenopus egg extracts. Biochem Biophys Res Commun. 1994 Jan 28;198(2):536-45.
104	New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide. J Med Chem. 2008 Dec 25;51(24):7800-5.
105	Pyridine analogues of nimesulide: design, synthesis, and in vitro and in vivo pharmacological evaluation as promising cyclooxygenase 1 and 2 inhibi... J Med Chem. 2009 Oct 8;52(19):5864-71.
106	Design, synthesis, and pharmacological evaluation of pyridinic analogues of nimesulide as cyclooxygenase-2 selective inhibitors. J Med Chem. 2004 Dec 30;47(27):6749-59.
107	COX, LOX and platelet aggregation inhibitory properties of Lauraceae neolignans. Bioorg Med Chem Lett. 2009 Dec 15;19(24):6922-5.
108	The cyclooxygenase inhibitor flurbiprofen reduces radiation-induced angiogenic growth factor secretion of squamous cell carcinoma cell lines. Ann N Y Acad Sci. 2004 Dec;1030:37-42.
109	Structure-based design, synthesis, and biological evaluation of indomethacin derivatives as cyclooxygenase-2 inhibiting nitric oxide donors. J Med Chem. 2007 Dec 13;50(25):6367-82.
110	A selective inhibitor of p38 MAP kinase, SB202190, induced apoptotic cell death of a lipopolysaccharide-treated macrophage-like cell line, J774.1. Biochim Biophys Acta. 2000 Oct 18;1502(2):207-23.
111	PAC 10649 Pacific licensing offer, Worldwide excluding South Korea. R & D Focus Drug News. September 22, 2003.
112	Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43.
113	Diazen-1-ium-1,2-diolated nitric oxide donor ester prodrugs of 5-(4-hydroxymethylphenyl)-1-(4-aminosulfonylphenyl)-3-trifluoromethyl-1H-pyrazole an... Bioorg Med Chem. 2008 Nov 15;16(22):9694-8.
114	Selective synthesis and biological evaluation of sulfate-conjugated resveratrol metabolites. J Med Chem. 2010 Jul 8;53(13):5033-43.
115	SB-239063, a potent and selective inhibitor of p38 map kinase: preclinical pharmacokinetics and species-specific reversible isomerization. Pharm Res. 2001 Sep;18(9):1336-44.
116	In silico search for multi-target anti-inflammatories in Chinese herbs and formulas. Bioorg Med Chem. 2010 Mar 15;18(6):2204-2218.
117	US patent application no. 6,274,627, Conjugates of dithiocarbamate disulfides with pharmacologically active agents and uses therefor.
118	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
119	Divergent cyclooxygenase responses to fatty acid structure and peroxide level in fish and mammalian prostaglandin H synthases. FASEB J. 2006 Jun;20(8):1097-108.
120	Structural basis of fatty acid substrate binding to cyclooxygenase-2. J Biol Chem. 2010 Jul 16;285(29):22152-63.
121	Peroxidative free radical formation and O-demethylation of etoposide(VP-16) and teniposide(VM-26). Biochem Biophys Res Commun. 1986 Feb 26;135(1):215-20.
122	Health implications of high dietary omega-6 polyunsaturated Fatty acids. J Nutr Metab. 2012;2012:539426.
123	PharmGKB summary: very important pharmacogene information for PTGS2. Pharmacogenet Genomics. 2011 Sep;21(9):607-13.