Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT22C0PD)

DOT Name Beta-casein (CSN2)
Gene Name CSN2
Related Disease
Carcinoma ( )
Alzheimer disease ( )
Cardiovascular disease ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Coronary atherosclerosis ( )
Lactose intolerance ( )
Myocardial ischemia ( )
Pancreatic cancer ( )
Squamous cell carcinoma ( )
Type-1 diabetes ( )
Type-1/2 diabetes ( )
Hepatocellular carcinoma ( )
Undifferentiated carcinoma ( )
Acute lymphocytic leukaemia ( )
Acute myelogenous leukaemia ( )
Ataxia-telangiectasia ( )
Autoimmune disease ( )
Cervical cancer ( )
Cervical carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
Coeliac disease ( )
Multiple sclerosis ( )
Neoplasm ( )
UniProt ID
CASB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00363
Sequence
MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQ
PQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKS
PTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIP
QQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
Function Important role in determination of the surface properties of the casein micelles.
Tissue Specificity Mammary gland specific. Secreted in milk.
KEGG Pathway
Prolactin sig.ling pathway (hsa04917 )
Reactome Pathway
Nuclear signaling by ERBB4 (R-HSA-1251985 )

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Carcinoma DISH9F1N Definitive Biomarker [1]
Alzheimer disease DISF8S70 Strong Biomarker [2]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [3]
Colon cancer DISVC52G Strong Altered Expression [4]
Colon carcinoma DISJYKUO Strong Altered Expression [4]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [5]
Coronary atherosclerosis DISKNDYU Strong Biomarker [3]
Lactose intolerance DISGENW9 Strong Biomarker [6]
Myocardial ischemia DISFTVXF Strong Biomarker [7]
Pancreatic cancer DISJC981 Strong Biomarker [8]
Squamous cell carcinoma DISQVIFL Strong Biomarker [9]
Type-1 diabetes DIS7HLUB Strong Genetic Variation [10]
Type-1/2 diabetes DISIUHAP Strong Biomarker [7]
Hepatocellular carcinoma DIS0J828 moderate Biomarker [11]
Undifferentiated carcinoma DISIAZST Disputed Biomarker [1]
Acute lymphocytic leukaemia DISPX75S Limited Biomarker [12]
Acute myelogenous leukaemia DISCSPTN Limited Biomarker [12]
Ataxia-telangiectasia DISP3EVR Limited Genetic Variation [13]
Autoimmune disease DISORMTM Limited Biomarker [13]
Cervical cancer DISFSHPF Limited Biomarker [14]
Cervical carcinoma DIST4S00 Limited Biomarker [14]
Childhood acute lymphoblastic leukemia DISJ5D6U Limited Biomarker [12]
Coeliac disease DISIY60C Limited Biomarker [13]
Multiple sclerosis DISB2WZI Limited Genetic Variation [13]
Neoplasm DISZKGEW Limited Altered Expression [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Beta-casein (CSN2). [16]
Linalool DMGZQ5P Investigative Linalool increases the expression of Beta-casein (CSN2). [18]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Beta-casein (CSN2). [17]
------------------------------------------------------------------------------------

References

1 Global gene expression profiling of chemically induced rat mammary gland carcinomas and adenomas.Toxicol Pathol. 2005;33(7):768-75. doi: 10.1080/01926230500437027.
2 The potential inhibitory effect of -casein on the aggregation and deposition of A(1-42) fibrils in Alzheimer's disease: insight from in-vitro and in-silico studies.J Biomol Struct Dyn. 2018 Jun;36(8):2118-2130. doi: 10.1080/07391102.2017.1345326. Epub 2017 Jul 4.
3 Polymorphism of bovine beta-casein and its potential effect on human health.J Appl Genet. 2007;48(3):189-98. doi: 10.1007/BF03195213.
4 DDA1 promotes stage IIB-IIC colon cancer progression by activating NFB/CSN2/GSK-3 signaling.Oncotarget. 2016 Apr 12;7(15):19794-812. doi: 10.18632/oncotarget.7847.
5 Prognostic Significance of CSN2, CD8, and MMR Status-Associated Nomograms in Patients with Colorectal Cancer.Transl Oncol. 2018 Oct;11(5):1202-1212. doi: 10.1016/j.tranon.2018.07.006. Epub 2018 Jul 31.
6 Comparison of the impact of bovine milk -casein variants on digestive comfort in females self-reporting dairy intolerance: a randomized controlled trial.Am J Clin Nutr. 2020 Jan 1;111(1):149-160. doi: 10.1093/ajcn/nqz279.
7 Analysis of Slovak Spotted breed for bovine beta casein A1 variant as risk factor for human health.Acta Biochim Pol. 2013;60(4):799-801.
8 Identification of a novel type of CA19-9 carrier in human bile and sera of cancer patients: an implication of the involvement in nonsecretory exocytosis.J Proteome Res. 2010 Dec 3;9(12):6345-53. doi: 10.1021/pr100600u. Epub 2010 Nov 10.
9 Cloning and characterization of a tumor-associated antigen, beta-casein-like protein.Biochem Biophys Res Commun. 2001 Jun 8;284(2):340-5. doi: 10.1006/bbrc.2001.4966.
10 Dietary Cows' Milk Protein A1 Beta-Casein Increases the Incidence of T1D in NOD Mice.Nutrients. 2018 Sep 12;10(9):1291. doi: 10.3390/nu10091291.
11 RMP promotes epithelial-mesenchymal transition through NF-B/CSN2/Snail pathway in hepatocellular carcinoma.Oncotarget. 2017 Jun 20;8(25):40373-40388. doi: 10.18632/oncotarget.16177.
12 STAT-related transcription factors are constitutively activated in peripheral blood cells from acute leukemia patients.Blood. 1996 Mar 1;87(5):1692-7.
13 Antibodies to bovine beta-casein in diabetes and other autoimmune diseases.Horm Metab Res. 2002 Aug;34(8):455-9. doi: 10.1055/s-2002-33595.
14 Specific detection of circulating tumor cells by reverse transcriptase-polymerase chain reaction of a beta-casein-like protein, preferentially expressed in malignant neoplasms.Anticancer Res. 2001 Jul-Aug;21(4A):2547-51.
15 Regulation of DCIS to invasive breast cancer progression by Singleminded-2s (SIM2s).Oncogene. 2013 May 23;32(21):2631-9. doi: 10.1038/onc.2012.286. Epub 2012 Jul 9.
16 Differential anti-proliferative actions of peroxisome proliferator-activated receptor-gamma agonists in MCF-7 breast cancer cells. Biochem Pharmacol. 2006 Aug 28;72(5):530-40. doi: 10.1016/j.bcp.2006.05.009. Epub 2006 Jun 27.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
18 Linalool preferentially induces robust apoptosis of a variety of leukemia cells via upregulating p53 and cyclin-dependent kinase inhibitors. Toxicology. 2010 Jan 31;268(1-2):19-24. doi: 10.1016/j.tox.2009.11.013. Epub 2009 Nov 14.