Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3OHO0O)

• DOT Name: Dynein axonemal assembly factor 3 (DNAAF3)
• Gene Name: DNAAF3
• Related Disease:
  Primary ciliary dyskinesia 2
  Scleroderma
  Spinocerebellar ataxia type 37
  Systemic sclerosis
  Advanced cancer
  Bronchiectasis
  Cystic fibrosis
  Fleck corneal dystrophy
  Hydrocephalus
  Inflammatory bowel disease
  Male infertility
  Pancreatic cancer
  Primary ciliary dyskinesia 1
  Prostate cancer
  Prostate carcinoma
  Urinary tract infection
  Castration-resistant prostate carcinoma
  Primary ciliary dyskinesia
  Neoplasm
  Asthma
  Autism
  Cognitive impairment
  Venous thromboembolism
• UniProt ID: DAAF3_HUMAN
• Pfam ID: PF14737 ; PF14740
• Sequence:
  MTTPAGSGSGFGSVSWWGLSPALDLQAESPPVDPDSQADTVHSNPELDVLLLGSVDGRHL
  LRTLSRAKFWPRRRFNFFVLENNLEAVARHMLIFSLALEEPEKMGLQERSETFLEVWGNA
  LLRPPVAAFVRAQADLLAHLVPEPDRLEEQLPWLSLRALKFRERDALEAVFRFWAGGEKG
  PQAFPMSRLWDSRLRHYLGSRYDARRGVSDWDLRMKLHDRGAQVIHPQEFRRWRDTGVAF
  ELRDSSAYHVPNRTLASGRLLSYRGERVAARGYWGDIATGPFVAFGIEADDESLLRTSNG
  QPVKTAGEITQHNVTELLRDVAAWGRARATGGDLEEQQHAEGSPEPGTPAAPTPESFTVH
  FLPLNSAQTLHHKSCYNGRFQLLYVACGMVHLLIPELGACVAPGGNLIVELARYLVDVRQ
  EQLQGFNTRVRELAQAAGFAPQTGARPSETFARFCKSQESALGNTVPAVEPGTPPLDILA
  QPLEASNPALEGLTQPLQGGTPHCEPCQLPSESPGSLSEVLAQPQGALAPPNCESDSKTG
  V
• Function: Required for the assembly of axonemal inner and outer dynein arms. Involved in preassembly of dyneins into complexes before their transport into cilia.

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Primary ciliary dyskinesia 2	DISS6LAI	Definitive	Autosomal recessive	[1]
Scleroderma	DISVQ342	Definitive	Biomarker	[2]
Spinocerebellar ataxia type 37	DIS3KNNO	Definitive	Genetic Variation	[3]
Systemic sclerosis	DISF44L6	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[4]
Bronchiectasis	DIS5MYEE	Strong	Biomarker	[5]
Cystic fibrosis	DIS2OK1Q	Strong	Genetic Variation	[6]
Fleck corneal dystrophy	DISERQJ1	Strong	Biomarker	[7]
Hydrocephalus	DISIZUF7	Strong	Biomarker	[8]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[9]
Male infertility	DISY3YZZ	Strong	Biomarker	[10]
Pancreatic cancer	DISJC981	Strong	Biomarker	[11]
Primary ciliary dyskinesia 1	DISPGX6H	Strong	Biomarker	[8]
Prostate cancer	DISF190Y	Strong	Biomarker	[12]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[12]
Urinary tract infection	DISMT6UV	Strong	Biomarker	[13]
Castration-resistant prostate carcinoma	DISVGAE6	moderate	Biomarker	[14]
Primary ciliary dyskinesia	DISOBC7V	Supportive	Autosomal dominant	[8]
Neoplasm	DISZKGEW	Disputed	Biomarker	[15]
Asthma	DISW9QNS	Limited	Biomarker	[16]
Autism	DISV4V1Z	Limited	Altered Expression	[17]
Cognitive impairment	DISH2ERD	Limited	Altered Expression	[17]
Venous thromboembolism	DISUR7CR	Limited	Biomarker	[18]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Dynein axonemal assembly factor 3 (DNAAF3).	[19]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[20]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[21]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[22]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[23]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[24]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[25]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[26]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[27]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[28]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[29]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[31]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Dynein axonemal assembly factor 3 (DNAAF3).	[32]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Chromosome changes in lymphocytes of patients with scleroderma.Ann Genet. 1995;38(3):145-50.
• [3] Mutational mechanism for DAB1 (ATTTC)(n) insertion in SCA37: ATTTT repeat lengthening and nucleotide substitution.Hum Mutat. 2019 Apr;40(4):404-412. doi: 10.1002/humu.23704. Epub 2019 Jan 9.
• [4] Predictors of post-cancer diagnosis resignation among Japanese cancer survivors.J Cancer Surviv. 2020 Apr;14(2):106-113. doi: 10.1007/s11764-019-00827-0. Epub 2019 Nov 13.
• [5] Predicting factors for chronic colonization of Pseudomonas aeruginosa in bronchiectasis.Eur J Clin Microbiol Infect Dis. 2019 Dec;38(12):2299-2304. doi: 10.1007/s10096-019-03675-z. Epub 2019 Aug 31.
• [6] Variation in Cilia Protein Genes and Progression of Lung Disease in Cystic Fibrosis.Ann Am Thorac Soc. 2018 Apr;15(4):440-448. doi: 10.1513/AnnalsATS.201706-451OC.
• [7] Age-Dependent Subchondral Bone Remodeling and Cartilage Repair in a Minipig Defect Model.Tissue Eng Part C Methods. 2017 Nov;23(11):745-753. doi: 10.1089/ten.TEC.2017.0109. Epub 2017 Oct 27.
• [8] Mutations in axonemal dynein assembly factor DNAAF3 cause primary ciliary dyskinesia. Nat Genet. 2012 Mar 4;44(4):381-9, S1-2. doi: 10.1038/ng.1106.
• [9] Resources used in the treatment of perianal Crohn's disease and the results in a real-life cohort.Gastroenterol Hepatol. 2018 Jun-Jul;41(6):353-361. doi: 10.1016/j.gastrohep.2018.04.006. Epub 2018 May 11.
• [10] Sperm defects in primary ciliary dyskinesia and related causes of male infertility.Cell Mol Life Sci. 2020 Jun;77(11):2029-2048. doi: 10.1007/s00018-019-03389-7. Epub 2019 Nov 28.
• [11] Pancreatic Cancer Database: an integrative resource for pancreatic cancer.Cancer Biol Ther. 2014 Aug;15(8):963-7. doi: 10.4161/cbt.29188. Epub 2014 May 19.
• [12] High Norwegian prostate cancer mortality: evidence of over-reporting.Scand J Urol. 2018 Apr;52(2):122-128. doi: 10.1080/21681805.2017.1421260. Epub 2018 Jan 11.
• [13] Is there a conflict between general practitioners applying guidelines for antibiotic prescribing and including their patients' preferences?.Patient Prefer Adherence. 2017 Dec 21;12:9-19. doi: 10.2147/PPA.S147616. eCollection 2018.
• [14] Rare sugar D-allose induces programmed cell death in hormone refractory prostate cancer cells.Apoptosis. 2008 Sep;13(9):1121-34. doi: 10.1007/s10495-008-0232-7.
• [15] Genetic alterations and tumor immune attack in Yo paraneoplastic cerebellar degeneration.Acta Neuropathol. 2018 Apr;135(4):569-579. doi: 10.1007/s00401-017-1802-y. Epub 2018 Jan 3.
• [16] Ventilation Inhomogeneity and Bronchial Basement Membrane Changes in Chronic Neutrophilic Airway Inflammation.Chest. 2020 Apr;157(4):779-789. doi: 10.1016/j.chest.2019.10.023. Epub 2019 Nov 9.
• [17] Reelin signaling is impaired in autism.Biol Psychiatry. 2005 Apr 1;57(7):777-87. doi: 10.1016/j.biopsych.2004.12.018.
• [18] Clinical and laboratory characteristics of children with venous thromboembolism and protein C-deficiency: an observational Israeli-German cohort study.Br J Haematol. 2014 Nov;167(3):385-93. doi: 10.1111/bjh.13039. Epub 2014 Jul 18.
• [19] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [20] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [21] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [22] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [23] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [24] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [25] Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
• [26] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [27] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [28] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [29] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [30] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [31] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [32] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.