Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT59J1GY)

DOT Name Emopamil-binding protein-like (EBPL)
Synonyms Emopamil-binding-related protein
Gene Name EBPL
Related Disease
Parkinson disease ( )
Advanced cancer ( )
Anxiety ( )
Anxiety disorder ( )
Atrial fibrillation ( )
Attention deficit hyperactivity disorder ( )
Autism ( )
Depression ( )
Insomnia ( )
Juvenile idiopathic arthritis ( )
Major depressive disorder ( )
Obsessive compulsive disorder ( )
Pancreatic cancer ( )
Pancreatitis ( )
Post-traumatic stress disorder ( )
Schizophrenia ( )
Syndromic X-linked intellectual disability Lubs type ( )
Tuberculosis ( )
Alcohol dependence ( )
Autism spectrum disorder ( )
Lyme disease ( )
Arrhythmia ( )
Atrial septal defect ( )
Eating disorder ( )
Erectile dysfunction ( )
Pervasive developmental disorder ( )
Phobic disorder ( )
Psychotic disorder ( )
Specific language impairment ( )
UniProt ID
EBPL_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05241
Sequence
MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGP
FVYLSLVGNVANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAI
VKEKYYRHFLQITLCVCELYGCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIP
GLLLWQSWLELKKMHQKETSSVKKFQ
Function Does not possess sterol isomerase activity and does not bind sigma ligands.
Tissue Specificity Widely expressed with highest levels in liver, lung and kidney.

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Parkinson disease DISQVHKL Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Anxiety DISIJDBA Strong Genetic Variation [3]
Anxiety disorder DISBI2BT Strong Genetic Variation [3]
Atrial fibrillation DIS15W6U Strong Biomarker [4]
Attention deficit hyperactivity disorder DISL8MX9 Strong Biomarker [5]
Autism DISV4V1Z Strong Biomarker [6]
Depression DIS3XJ69 Strong Biomarker [7]
Insomnia DIS0AFR7 Strong Biomarker [8]
Juvenile idiopathic arthritis DISQZGBV Strong Genetic Variation [9]
Major depressive disorder DIS4CL3X Strong Biomarker [10]
Obsessive compulsive disorder DIS1ZMM2 Strong Biomarker [11]
Pancreatic cancer DISJC981 Strong Biomarker [2]
Pancreatitis DIS0IJEF Strong Biomarker [2]
Post-traumatic stress disorder DISHL1EY Strong Biomarker [12]
Schizophrenia DISSRV2N Strong Biomarker [13]
Syndromic X-linked intellectual disability Lubs type DISJ54F6 Strong Genetic Variation [14]
Tuberculosis DIS2YIMD Strong Biomarker [15]
Alcohol dependence DIS4ZSCO moderate Genetic Variation [16]
Autism spectrum disorder DISXK8NV moderate Biomarker [17]
Lyme disease DISO70G5 moderate Biomarker [18]
Arrhythmia DISFF2NI Limited Genetic Variation [19]
Atrial septal defect DISJT76B Limited Biomarker [17]
Eating disorder DISVGXN0 Limited Biomarker [20]
Erectile dysfunction DISD8MTH Limited Biomarker [20]
Pervasive developmental disorder DIS51975 Limited Biomarker [21]
Phobic disorder DISX6DUL Limited Biomarker [22]
Psychotic disorder DIS4UQOT Limited Genetic Variation [23]
Specific language impairment DISEKRML Limited Biomarker [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 29 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Emopamil-binding protein-like (EBPL). [25]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Emopamil-binding protein-like (EBPL). [26]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Emopamil-binding protein-like (EBPL). [27]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Emopamil-binding protein-like (EBPL). [28]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Emopamil-binding protein-like (EBPL). [29]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Emopamil-binding protein-like (EBPL). [30]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Emopamil-binding protein-like (EBPL). [31]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Emopamil-binding protein-like (EBPL). [32]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Emopamil-binding protein-like (EBPL). [33]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Emopamil-binding protein-like (EBPL). [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 N400 and emotional word processing in Parkinson's disease.Neuropsychology. 2017 Sep;31(6):585-595. doi: 10.1037/neu0000333. Epub 2017 Mar 13.
2 Values of mutations of K-ras oncogene at codon 12 in detection of pancreatic cancer: 15-year experience.World J Gastroenterol. 2004 Feb 15;10(4):471-5. doi: 10.3748/wjg.v10.i4.471.
3 The effect of expressive writing on the error-related negativity among individuals with chronic worry.Psychophysiology. 2018 Feb;55(2):10.1111/psyp.12990. doi: 10.1111/psyp.12990. Epub 2017 Sep 8.
4 Neural substrate of posterior left atrium: A novel modulation for inducibility and remodeling of atrial fibrillation in canine.PLoS One. 2017 May 5;12(5):e0176626. doi: 10.1371/journal.pone.0176626. eCollection 2017.
5 Sensitivity to Peer Feedback in Young Adolescents with Symptoms of ADHD: Examination of Neurophysiological and Self-Report Measures.J Abnorm Child Psychol. 2019 Apr;47(4):605-617. doi: 10.1007/s10802-018-0470-2.
6 Speech-specific categorical perception deficit in autism: An Event-Related Potential study of lexical tone processing in Mandarin-speaking children.Sci Rep. 2017 Feb 22;7:43254. doi: 10.1038/srep43254.
7 Hypomania and depression associated with distinct neural activity for immediate and future rewards.Psychophysiology. 2019 Mar;56(3):e13301. doi: 10.1111/psyp.13301. Epub 2018 Nov 15.
8 Attentional bias towards sleep-related stimuli in insomnia disorder: a behavioural and ERP study.J Sleep Res. 2018 Jun;27(3):e12652. doi: 10.1111/jsr.12652. Epub 2018 Jan 10.
9 Self-rated walking disability and dynamic ankle joint stiffness in children and adolescents with Juvenile Idiopathic Arthritis receiving intraarticular corticosteroid joint injections of the foot.Gait Posture. 2019 Jan;67:257-261. doi: 10.1016/j.gaitpost.2018.10.024. Epub 2018 Oct 21.
10 Attentional bias in MDD: ERP components analysis and classification using a dot-probe task.Comput Methods Programs Biomed. 2018 Oct;164:169-179. doi: 10.1016/j.cmpb.2018.07.003. Epub 2018 Jul 17.
11 A multi-method analysis of incompleteness in behavioral treatment of contamination-based OCD.Behav Res Ther. 2019 Mar;114:1-6. doi: 10.1016/j.brat.2018.12.008. Epub 2018 Dec 21.
12 Processing of affective words in adolescent PTSD-Attentional bias toward social threat.Psychophysiology. 2019 Nov;56(11):e13444. doi: 10.1111/psyp.13444. Epub 2019 Jul 25.
13 Context Dependence Signature, Stimulus Properties and Stimulus Probability as Predictors of ERP Amplitude Variability.Front Hum Neurosci. 2019 Feb 26;13:39. doi: 10.3389/fnhum.2019.00039. eCollection 2019.
14 Distinguishing response to names in Rett and MECP2 Duplication syndrome: An ERP study of auditory social information processing.Brain Res. 2017 Nov 15;1675:71-77. doi: 10.1016/j.brainres.2017.08.028. Epub 2017 Sep 1.
15 Interaction of Erp Protein of Mycobacterium tuberculosis with Rv2212 Enhances Intracellular Survival of Mycobacterium smegmatis.J Bacteriol. 2016 Sep 22;198(20):2841-52. doi: 10.1128/JB.00120-16. Print 2016 Oct 15.
16 Linkage and linkage disequilibrium mapping of ERP and EEG phenotypes.Biol Psychol. 2002 Oct;61(1-2):229-48. doi: 10.1016/s0301-0511(02)00060-1.
17 ERP evidence of semantic processing in children with ASD.Dev Cogn Neurosci. 2019 Apr;36:100640. doi: 10.1016/j.dcn.2019.100640. Epub 2019 Mar 23.
18 Expression of Borrelia burgdorferi erp genes during infection of non-human primates.Microb Pathog. 2005 Jul-Aug;39(1-2):27-33. doi: 10.1016/j.micpath.2005.04.001.
19 Proarrhythmia in KCNJ2-linked short QT syndrome: insights from modelling.Cardiovasc Res. 2012 Apr 1;94(1):66-76. doi: 10.1093/cvr/cvs082. Epub 2012 Feb 2.
20 Evidence for ERP biomarkers of eating disorder symptoms in women.Biol Psychol. 2017 Feb;123:205-219. doi: 10.1016/j.biopsycho.2016.12.016. Epub 2017 Jan 3.
21 Non-speech and speech pitch perception among Cantonese-speaking children with autism spectrum disorder: An ERP study.Neurosci Lett. 2019 Jun 11;703:205-212. doi: 10.1016/j.neulet.2019.03.021. Epub 2019 Mar 16.
22 Is this blood? An ERP study on the visual identification of red fluids in patients with blood phobia.Brain Res. 2018 Jan 1;1678:195-202. doi: 10.1016/j.brainres.2017.10.029. Epub 2017 Oct 28.
23 Social aversive conditioning in youth at clinical high risk for psychosis and with psychosis: An ERP study.Schizophr Res. 2018 Dec;202:291-296. doi: 10.1016/j.schres.2018.06.027. Epub 2018 Jun 21.
24 Implicit learning seems to come naturally for children with autism, but not for children with specific language impairment: Evidence from behavioral and ERP data.Autism Res. 2018 Jul;11(7):1050-1061. doi: 10.1002/aur.1954. Epub 2018 Apr 20.
25 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
26 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
27 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
28 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
29 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
30 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
31 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
32 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
33 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
34 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.