General Information of Drug Off-Target (DOT) (ID: OT5G38CH)

DOT Name Multiple epidermal growth factor-like domains protein 8 (MEGF8)
Synonyms Multiple EGF-like domains protein 8; Epidermal growth factor-like protein 4; EGF-like protein 4
Gene Name MEGF8
Related Disease
Lung adenocarcinoma ( )
RAB23-related Carpenter syndrome ( )
Advanced cancer ( )
Chronic kidney disease ( )
Colitis ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Coronary heart disease ( )
Crohn disease ( )
Endometriosis ( )
Epithelial ovarian cancer ( )
Female hypogonadism ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Intrahepatic cholangiocarcinoma ( )
MEGF8-related Carpenter syndrome ( )
Neoplasm ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Polydactyly ( )
Stomach cancer ( )
Carpenter syndrome ( )
Esophageal adenocarcinoma ( )
Familial multiple trichoepithelioma ( )
Parkinson disease ( )
UniProt ID
MEGF8_HUMAN
Pfam ID
PF00431 ; PF12947 ; PF07645 ; PF13415 ; PF13418 ; PF13854 ; PF00053 ; PF01437
Sequence
MALGKVLAMALVLALAVLGSLSPGARAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLL
HLFSDANYNLLGFNASFRFSLCPGGCQSHGQCQPPGVCACEPGWGGPDCGLQECSAYCGS
HGTCASPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSARDPAFSARIGAAGAFLSPPG
LLAVFGGQDLNNALGDLVLYNFSANTWESWDLSPAPAARHSHVAVAWAGSLVLMGGELAD
GSLTNDVWAFSPLGRGHWELLAPPASSSSGPPGLAGHAAALVDDVWLYVSGGRTPHDLFS
SGLFRFRLDSTSGGYWEQVIPAGGRPPAATGHSMVFHAPSRALLVHGGHRPSTARFSVRV
NSTELFHVDRHVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG
IFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDL
MAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTPLGACPAA
SCLGLGRLLGDCQACLAFSSPTAPPRGPGTLGWCVHNESCLPRPEQARCRGEQISGTVGW
WGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNTSQPDKVSIVRSTTITLTPSAETDVSL
VYRGFIYPMLPGGPGGPGAEDVAVWTRAQRLHVLARMARGPDTENMEEVGRWVAHQEKET
RRLQRPGSARLFPLPGRDHKYAVEIQGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFL
EPYRSSSCTSYSSCLGCLADQGCGWCLTSATCHLRQGGAHCGDDGAGGSLLVLVPTLCPL
CEEHRDCHACTQDPFCEWHQSTSRKGDAACSRRGRGRGALKSPEECPPLCSQRLTCEDCL
ANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCDGFLTCHECLQSHE
CGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPVALPARWAYARCPDVDECRL
GLARCHPRATCLNTPLSYECHCQRGYQGDGISHCNRTCLEDCGHGVCSGPPDFTCVCDLG
WTSDLPPPTPAPGPPAPRCSRDCGCSFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSFG
NATGSRGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCF
RECGGRALLTNVSSVALGSRRVGGLLPPGGGAARAGPGLSYCVWVVSATEELQPCAPGTL
CPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQAL
SGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWA
GPHCRMALCPENCNAHTGAGTCNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLS
ADTASRFLHRLGHTMVDGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGG
PGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWRQEKAPQTVELPAV
AGHTLTARRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYH
EATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKRDRMRNVRGSSRGLG
QVPGEQPGSWGFREVRKKMALWAALAGTGGFLEEISPHLKEPRPRLFHASALLGDTMVVL
GGRSDPDEFSSDVLLYQVNCNAWLLPDLTRSASVGPPMEESVAHAVAAVGSRLYISGGFG
GVALGRLLALTLPPDPCRLLSSPEACNQSGACTWCHGACLSGDQAHRLGCGGSPCSPMPR
SPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRI
NQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHS
LLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQQCLSPSYLPL
RCMAGGCGRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGGGRCMEGGLSGPRD
GLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCKTGYTMDNMTGLCR
PVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCRNHTKGS
HCEQCLPLFVGSAVGGGTCRPCHAFCRGNSHICISRKELQMSKGEPKKYSLDPEEIENWV
TEGPSEDEAVCVNCQNNSYGEKCESCLQGYFLLDGKCTKCQCNGHADTCNEQDGTGCPCQ
NNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPTSQTN
CFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTG
VHTVHIQPPPAPPPPPPPADGGPRGAGDPGGAGASSGPGAPAEPRVREVWPRGLITYVTV
TEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLLFFR
QDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRPFAKV
TVCFPPDPTAPASAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPMGGGCCPPAIPATT
AGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGGGGGA
GGSGHGTGAGRKGLLSQDNLTSMSL
Function Acts as a negative regulator of hedgehog signaling.
KEGG Pathway
Hedgehog sig.ling pathway (hsa04340 )

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung adenocarcinoma DISD51WR Definitive Altered Expression [1]
RAB23-related Carpenter syndrome DISR9P09 Definitive Autosomal recessive [2]
Advanced cancer DISAT1Z9 Strong Altered Expression [3]
Chronic kidney disease DISW82R7 Strong Biomarker [4]
Colitis DISAF7DD Strong Altered Expression [5]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [6]
Colorectal neoplasm DISR1UCN Strong Altered Expression [7]
Coronary heart disease DIS5OIP1 Strong Biomarker [8]
Crohn disease DIS2C5Q8 Strong Biomarker [5]
Endometriosis DISX1AG8 Strong Biomarker [9]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [9]
Female hypogonadism DISWASB4 Strong Biomarker [9]
Gastric cancer DISXGOUK Strong Biomarker [10]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [11]
Intrahepatic cholangiocarcinoma DIS6GOC8 Strong Altered Expression [12]
MEGF8-related Carpenter syndrome DIS3D9MI Strong Autosomal recessive [13]
Neoplasm DISZKGEW Strong Altered Expression [12]
Ovarian cancer DISZJHAP Strong Biomarker [9]
Ovarian neoplasm DISEAFTY Strong Biomarker [9]
Polydactyly DIS25BMZ Strong Biomarker [14]
Stomach cancer DISKIJSX Strong Biomarker [10]
Carpenter syndrome DISU690E Supportive Autosomal recessive [14]
Esophageal adenocarcinoma DISODWFP Limited Genetic Variation [15]
Familial multiple trichoepithelioma DISKZAUY Limited Biomarker [15]
Parkinson disease DISQVHKL Limited Biomarker [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [17]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [18]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [19]
Quercetin DM3NC4M Approved Quercetin increases the expression of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [21]
Marinol DM70IK5 Approved Marinol increases the expression of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [22]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [23]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [24]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Multiple epidermal growth factor-like domains protein 8 (MEGF8). [20]
------------------------------------------------------------------------------------

References

1 Reduced selenium-binding protein 1 expression is associated with poor outcome in lung adenocarcinomas.J Pathol. 2004 Mar;202(3):321-9. doi: 10.1002/path.1524.
2 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
3 Selenium-Binding Protein 1 in Human Health and Disease.Int J Mol Sci. 2018 Nov 2;19(11):3437. doi: 10.3390/ijms19113437.
4 Identification of an argpyrimidine-modified protein in human red blood cells from schizophrenic patients: A possible biomarker for diseases involving carbonyl stress.Biochem Biophys Res Commun. 2017 Nov 4;493(1):573-577. doi: 10.1016/j.bbrc.2017.08.150. Epub 2017 Sep 1.
5 DNA Methylation of miR-122 Aggravates Oxidative Stress in Colitis Targeting SELENBP1 Partially by p65NF-B Signaling.Oxid Med Cell Longev. 2019 Mar 24;2019:5294105. doi: 10.1155/2019/5294105. eCollection 2019.
6 Transcriptional regulation and biological functions of selenium-binding protein 1 in colorectal cancer in vitro and in nude mouse xenografts.PLoS One. 2009 Nov 16;4(11):e7774. doi: 10.1371/journal.pone.0007774.
7 Expression of selenium-binding protein 1 characterizes intestinal cell maturation and predicts survival for patients with colorectal cancer.Mol Nutr Food Res. 2008 Nov;52(11):1289-99. doi: 10.1002/mnfr.200700331.
8 Efficacy and safety of the Shexiang Baoxin Pill for the treatment of coronary artery disease not amenable to revascularisation: study protocol for a randomised, placebo-controlled, double-blinded trial.BMJ Open. 2018 Feb 14;8(2):e018052. doi: 10.1136/bmjopen-2017-018052.
9 Selenium-Binding Protein 1 (SBP1) autoantibodies in ovarian disorders and ovarian cancer.Reproduction. 2017 Mar;153(3):277-284. doi: 10.1530/REP-16-0265. Epub 2016 Dec 13.
10 Selenium-binding protein 1 may decrease gastric cellular proliferation and migration.Int J Oncol. 2013 May;42(5):1620-9. doi: 10.3892/ijo.2013.1850. Epub 2013 Mar 7.
11 Invasive potential of hepatocellular carcinoma is enhanced by loss of selenium-binding protein 1 and subsequent upregulation of CXCR4.Am J Cancer Res. 2018 Jun 1;8(6):1040-1049. eCollection 2018.
12 Reduced selenium-binding protein 1 correlates with a poor prognosis in intrahepatic cholangiocarcinoma and promotes the cell epithelial-mesenchymal transition.Am J Transl Res. 2018 Nov 15;10(11):3567-3578. eCollection 2018.
13 Massively parallel sequencing identifies the gene Megf8 with ENU-induced mutation causing heterotaxy. Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3219-24. doi: 10.1073/pnas.0813400106. Epub 2009 Feb 13.
14 Mutations in multidomain protein MEGF8 identify a Carpenter syndrome subtype associated with defective lateralization. Am J Hum Genet. 2012 Nov 2;91(5):897-905. doi: 10.1016/j.ajhg.2012.08.027. Epub 2012 Oct 11.
15 Decreased selenium-binding protein 1 in esophageal adenocarcinoma results from posttranscriptional and epigenetic regulation and affects chemosensitivity.Clin Cancer Res. 2010 Apr 1;16(7):2009-21. doi: 10.1158/1078-0432.CCR-09-2801. Epub 2010 Mar 23.
16 Targeted discovery and validation of plasma biomarkers of Parkinson's disease.J Proteome Res. 2014 Nov 7;13(11):4535-45. doi: 10.1021/pr500421v. Epub 2014 Jun 11.
17 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
18 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
19 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
20 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
21 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
22 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
23 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
24 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
25 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.