Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5W1GPC)

• DOT Name: Anthrax toxin receptor 1 (ANTXR1)
• Synonyms: Tumor endothelial marker 8
• Gene Name: ANTXR1
• Related Disease:
  GAPO syndrome
  Sickle-cell anaemia
  Adenocarcinoma
  Alzheimer disease
  Anthrax
  Breast cancer
  Breast carcinoma
  Carcinoma
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Lung cancer
  Lung carcinoma
  Matthew-Wood syndrome
  Peripheral arterial disease
  Vascular disease
  Von willebrand disease
  Melanoma
  Triple negative breast cancer
  Capillary infantile hemangioma
  Neoplasm
  Squamous cell carcinoma
• UniProt ID: ANTR1_HUMAN
• PDB ID: 3N2N; 6ADL; 6ADM; 6ADR; 6CX1
• Pfam ID: PF05586 ; PF05587 ; PF00092
• Sequence:
  MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWN
  EIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYM
  HEGFERASEQIYYENRQGYRTASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGV
  KDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVV
  VRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMN
  DGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVIIKEVPPPPAE
  ESEEEDDDGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGEKGSTEEGAKLEKAKNARVKM
  PEQEYEFPEPRNLNNNMRRPSSPRKWYSPIKGKLDALWVLLRKGYDRVSVMRPQPGDTGR
  CINFTRVKNNQPAKYPLNNAYHTSSPPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTL
  PPPPQAPPPNRAPPPSRPPPRPSV
• Function: Plays a role in cell attachment and migration. Interacts with extracellular matrix proteins and with the actin cytoskeleton. Mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. Plays a role in the angiogenic response of cultured umbilical vein endothelial cells; (Microbial infection) Acts as a receptor for protective antigen (PA) of B.anthracis.
• Tissue Specificity: Detected in umbilical vein endothelial cells (at protein level). Highly expressed in tumor endothelial cells.
• KEGG Pathway: NOD-like receptor sig.ling pathway (hsa04621)
• Reactome Pathway: Uptake and function of anthrax toxins (R-HSA-5210891)

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
GAPO syndrome	DISI0CRA	Definitive	Autosomal recessive	[1]
Sickle-cell anaemia	DIS5YNZB	Definitive	Genetic Variation	[2]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[4]
Anthrax	DISFPT78	Strong	Genetic Variation	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Carcinoma	DISH9F1N	Strong	Altered Expression	[7]
Colon cancer	DISVC52G	Strong	Biomarker	[8]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[8]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[6]
Lung cancer	DISCM4YA	Strong	Altered Expression	[10]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[10]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[11]
Peripheral arterial disease	DIS78WFB	Strong	Biomarker	[12]
Vascular disease	DISVS67S	Strong	Biomarker	[12]
Von willebrand disease	DIS3TZCH	Strong	Genetic Variation	[13]
Melanoma	DIS1RRCY	moderate	Biomarker	[14]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[15]
Capillary infantile hemangioma	DISOWZY5	Limited	Autosomal dominant	[16]
Neoplasm	DISZKGEW	Limited	Altered Expression	[3]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[17]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[18]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[20]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[21]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[22]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[24]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[25]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[25]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[26]
Marinol	DM70IK5	Approved	Marinol increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[27]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[28]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[26]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[29]
Gemcitabine	DMSE3I7	Approved	Gemcitabine affects the expression of Anthrax toxin receptor 1 (ANTXR1).	[30]
Prednisolone	DMQ8FR2	Approved	Prednisolone increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[26]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[26]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[31]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[33]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Anthrax toxin receptor 1 (ANTXR1).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[18]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Anthrax toxin receptor 1 (ANTXR1).	[37]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Anthrax toxin receptor 1 (ANTXR1).	[23]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Anthrax toxin receptor 1 (ANTXR1).	[35]

References

• [1] Mutations in ANTXR1 cause GAPO syndrome. Am J Hum Genet. 2013 May 2;92(5):792-9. doi: 10.1016/j.ajhg.2013.03.023. Epub 2013 Apr 18.
• [2] ANTXR1 Intronic Variants Are Associated with Fetal Hemoglobin in the Arab-Indian Haplotype of Sickle Cell Disease.Acta Haematol. 2018;140(1):55-59. doi: 10.1159/000491688. Epub 2018 Aug 16.
• [3] ANTXR1 (TEM8) overexpression in gastric adenocarcinoma makes the protein a potential target of immunotherapy.Cancer Immunol Immunother. 2019 Oct;68(10):1597-1603. doi: 10.1007/s00262-019-02392-y. Epub 2019 Sep 14.
• [4] The Molecular Misreading of APP and UBB Induces a Humoral Immune Response in Alzheimer's Disease Patients with Diagnostic Ability.Mol Neurobiol. 2020 Feb;57(2):1009-1020. doi: 10.1007/s12035-019-01809-0. Epub 2019 Oct 26.
• [5] A biallelic ANTXR1 variant expands the anthrax toxin receptor associated phenotype to tooth agenesis.Am J Med Genet A. 2018 Apr;176(4):1015-1022. doi: 10.1002/ajmg.a.38625. Epub 2018 Feb 13.
• [6] Tumor endothelial marker 8 promotes cancer progression and metastasis.Oncotarget. 2018 Jul 10;9(53):30173-30188. doi: 10.18632/oncotarget.25734. eCollection 2018 Jul 10.
• [7] Expression of Tumour Endothelial Marker 8 in Canine Mammary Gland Tumour Cells.J Comp Pathol. 2019 Nov;173:30-40. doi: 10.1016/j.jcpa.2019.10.001. Epub 2019 Nov 4.
• [8] TAZ expression as a prognostic indicator in colorectal cancer.PLoS One. 2013;8(1):e54211. doi: 10.1371/journal.pone.0054211. Epub 2013 Jan 23.
• [9] TEM8/ANTXR1-Specific CAR T Cells as a Targeted Therapy for Triple-Negative Breast Cancer.Cancer Res. 2018 Jan 15;78(2):489-500. doi: 10.1158/0008-5472.CAN-16-1911. Epub 2017 Nov 28.
• [10] Effect of silencing TEM8 gene on proliferation, apoptosis, migration and invasion of XWLC?5 lung cancer cells.Mol Med Rep. 2018 Jan;17(1):911-917. doi: 10.3892/mmr.2017.7959. Epub 2017 Nov 3.
• [11] The Anthrax Toxin Receptor 1 (ANTXR1) Is Enriched in Pancreatic Cancer Stem Cells Derived from Primary Tumor Cultures.Stem Cells Int. 2019 May 2;2019:1378639. doi: 10.1155/2019/1378639. eCollection 2019.
• [12] Anthrax Toxin Receptor 1 Is Essential for Arteriogenesis in a Mouse Model of Hindlimb Ischemia.PLoS One. 2016 Jan 19;11(1):e0146586. doi: 10.1371/journal.pone.0146586. eCollection 2016.
• [13] Molecular Adjuvants Based on Plasmids Encoding Protein Aggregation Domains Affect Bone Marrow Niche Homeostasis.Curr Gene Ther. 2018 Feb 1;17(5):391-397. doi: 10.2174/1566523218666180105122626.
• [14] TEM8/ANTXR1 blockade inhibits pathological angiogenesis and potentiates tumoricidal responses against multiple cancer types.Cancer Cell. 2012 Feb 14;21(2):212-26. doi: 10.1016/j.ccr.2012.01.004.
• [15] TEM8/ANTXR1-specific CAR T cells mediate toxicity in vivo.PLoS One. 2019 Oct 17;14(10):e0224015. doi: 10.1371/journal.pone.0224015. eCollection 2019.
• [16] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [17] Bacillus anthracis Protective Antigen Shows High Specificity for a UV Induced Mouse Model of Cutaneous Squamous Cell Carcinoma.Front Med (Lausanne). 2019 Feb 12;6:22. doi: 10.3389/fmed.2019.00022. eCollection 2019.
• [18] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [19] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [20] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [21] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [22] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [23] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [24] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [25] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [26] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [27] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [28] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [29] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [30] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [31] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [32] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [33] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [34] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [35] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [36] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [37] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.