Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6FXC6K)

• DOT Name: DNA replication licensing factor MCM7 (MCM7)
• Synonyms: EC 3.6.4.12; CDC47 homolog; P1.1-MCM3
• Gene Name: MCM7
• UniProt ID: MCM7_HUMAN
• PDB ID: 6XTX; 6XTY; 7PFO; 7PLO; 7W1Y; 7W68; 8B9D
• EC Number: 3.6.4.12
• Pfam ID: PF00493 ; PF17855 ; PF14551 ; PF17207
• Sequence:
  MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
  ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
  SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
  TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
  SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
  HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
  GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
  DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
  RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
  HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
  TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
  IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
• Function: Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.
• KEGG Pathway:
  D. replication (hsa03030)
  Cell cycle (hsa04110)
• Reactome Pathway:
  Unwinding of DNA (R-HSA-176974)
  Assembly of the pre-replicative complex (R-HSA-68867)
  Orc1 removal from chromatin (R-HSA-68949)
  Activation of the pre-replicative complex (R-HSA-68962)
  Switching of origins to a post-replicative state (R-HSA-69052)
  Activation of ATR in response to replication stress (R-HSA-176187)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	DNA replication licensing factor MCM7 (MCM7) affects the response to substance of Fluorouracil.	[40]

40 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of DNA replication licensing factor MCM7 (MCM7).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of DNA replication licensing factor MCM7 (MCM7).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DNA replication licensing factor MCM7 (MCM7).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[11]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of DNA replication licensing factor MCM7 (MCM7).	[12]
Selenium	DM25CGV	Approved	Selenium increases the expression of DNA replication licensing factor MCM7 (MCM7).	[14]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of DNA replication licensing factor MCM7 (MCM7).	[15]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[16]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[17]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[18]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[19]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[20]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of DNA replication licensing factor MCM7 (MCM7).	[12]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[21]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[22]
Lapatinib	DM3BH1Y	Approved	Lapatinib decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[23]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[24]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[25]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of DNA replication licensing factor MCM7 (MCM7).	[7]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[26]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[27]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[20]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[28]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[30]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of DNA replication licensing factor MCM7 (MCM7).	[31]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of DNA replication licensing factor MCM7 (MCM7).	[33]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of DNA replication licensing factor MCM7 (MCM7).	[35]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[36]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[37]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of DNA replication licensing factor MCM7 (MCM7).	[38]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of DNA replication licensing factor MCM7 (MCM7).	[20]
PD98059	DMZC90M	Investigative	PD98059 affects the expression of DNA replication licensing factor MCM7 (MCM7).	[39]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine affects the methylation of DNA replication licensing factor MCM7 (MCM7).	[13]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of DNA replication licensing factor MCM7 (MCM7).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of DNA replication licensing factor MCM7 (MCM7).	[32]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of DNA replication licensing factor MCM7 (MCM7).	[34]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [7] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
• [10] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [11] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [12] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [13] Ornithine decarboxylase antizyme upregulates DNA-dependent protein kinase and enhances the nonhomologous end-joining repair of DNA double-strand breaks in human oral cancer cells. Biochemistry. 2007 Aug 7;46(31):8920-32. doi: 10.1021/bi7000328. Epub 2007 Jul 14.
• [14] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [15] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [16] Targeting of cell cycle and let-7a/STAT3 pathway by niclosamide inhibits proliferation, migration and invasion in oral squamous cell carcinoma cells. Biomed Pharmacother. 2017 Dec;96:434-442. doi: 10.1016/j.biopha.2017.09.149. Epub 2017 Oct 12.
• [17] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [18] Bortezomib induces caspase-dependent apoptosis in Hodgkin lymphoma cell lines and is associated with reduced c-FLIP expression: a gene expression profiling study with implications for potential combination therapies. Leuk Res. 2008 Feb;32(2):275-85. doi: 10.1016/j.leukres.2007.05.024. Epub 2007 Jul 19.
• [19] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [20] Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
• [21] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [22] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [23] CDK4/6 inhibition provides a potent adjunct to Her2-targeted therapies in preclinical breast cancer models. Genes Cancer. 2014 Jul;5(7-8):261-72. doi: 10.18632/genesandcancer.24.
• [24] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [25] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [26] Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
• [27] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [28] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [29] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [30] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [31] The genome-wide expression profile of Scrophularia ningpoensis-treated thapsigargin-stimulated U-87MG cells. Neurotoxicology. 2009 May;30(3):368-76.
• [32] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [33] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [34] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [35] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [36] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [37] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [38] Lithium suppresses cell proliferation by interrupting E2F-DNA interaction and subsequently reducing S-phase gene expression in prostate cancer. Prostate. 2007 Jun 15;67(9):976-88. doi: 10.1002/pros.20586.
• [39] Expression of minichromosome maintenance proteins in vascular smooth muscle cells is ERK/MAPK dependent. Exp Cell Res. 2003 Oct 15;290(1):28-37. doi: 10.1016/s0014-4827(03)00311-2.
• [40] Mechanistic and predictive profiling of 5-Fluorouracil resistance in human cancer cells. Cancer Res. 2004 Nov 15;64(22):8167-76. doi: 10.1158/0008-5472.CAN-04-0970.