Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6G4B8O)

DOT Name Alpha-amylase 1B (AMY1A)
Synonyms EC 3.2.1.1
Gene Name AMY1A
Related Disease
Adenocarcinoma ( )
Allergic rhinitis ( )
Anorexia nervosa cachexia ( )
Autism ( )
Autism spectrum disorder ( )
Carcinoid tumor ( )
Depression ( )
Enuresis ( )
Hepatocellular carcinoma ( )
High blood pressure ( )
Hyperinsulinemia ( )
Intellectual disability ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Major depressive disorder ( )
McCune-Albright syndrome ( )
Nocturia ( )
Non-insulin dependent diabetes ( )
Obstructive sleep apnea ( )
Periodontal disease ( )
Pervasive developmental disorder ( )
Pituitary gland disorder ( )
Plasma cell myeloma ( )
Schizophrenia ( )
Seasonal affective disorder ( )
Sjogren syndrome ( )
Ulcerative colitis ( )
Advanced cancer ( )
Post-traumatic stress disorder ( )
UniProt ID
AMY1B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.2.1.1
Pfam ID
PF00128 ; PF02806
Sequence
MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Function
Calcium-binding enzyme that initiates starch digestion in the oral cavity. Catalyzes the hydrolysis of internal (1->4)-alpha-D-glucosidic bonds, yielding a mixture of maltose, isomaltose, small amounts of glucose as well as small linear and branched oligosaccharides called dextrins.
KEGG Pathway
Starch and sucrose metabolism (hsa00500 )
Metabolic pathways (hsa01100 )
Salivary secretion (hsa04970 )
Pancreatic secretion (hsa04972 )
Carbohydrate digestion and absorption (hsa04973 )
Reactome Pathway
Digestion of dietary carbohydrate (R-HSA-189085 )

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adenocarcinoma DIS3IHTY Strong Biomarker [1]
Allergic rhinitis DIS3U9HN Strong Biomarker [2]
Anorexia nervosa cachexia DISFO5RQ Strong Biomarker [3]
Autism DISV4V1Z Strong Biomarker [4]
Autism spectrum disorder DISXK8NV Strong Altered Expression [4]
Carcinoid tumor DISMNRDC Strong Altered Expression [5]
Depression DIS3XJ69 Strong Biomarker [6]
Enuresis DISOTCOX Strong Altered Expression [7]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [8]
High blood pressure DISY2OHH Strong Biomarker [9]
Hyperinsulinemia DISIDWT6 Strong Biomarker [10]
Intellectual disability DISMBNXP Strong Altered Expression [4]
Lung adenocarcinoma DISD51WR Strong Altered Expression [11]
Lung cancer DISCM4YA Strong Genetic Variation [11]
Major depressive disorder DIS4CL3X Strong Biomarker [12]
McCune-Albright syndrome DISCO2QT Strong Altered Expression [12]
Nocturia DISD1F1J Strong Biomarker [7]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [13]
Obstructive sleep apnea DIS0SVD1 Strong Biomarker [9]
Periodontal disease DISJQHVN Strong Biomarker [14]
Pervasive developmental disorder DIS51975 Strong Altered Expression [4]
Pituitary gland disorder DIS7XB48 Strong Biomarker [15]
Plasma cell myeloma DIS0DFZ0 Strong Altered Expression [16]
Schizophrenia DISSRV2N Strong Biomarker [17]
Seasonal affective disorder DIS908VO Strong Biomarker [18]
Sjogren syndrome DISUBX7H Strong Altered Expression [19]
Ulcerative colitis DIS8K27O Strong Altered Expression [20]
Advanced cancer DISAT1Z9 Limited Biomarker [21]
Post-traumatic stress disorder DISHL1EY Limited Altered Expression [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 29 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Alpha-amylase 1B (AMY1A). [23]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Alpha-amylase 1B (AMY1A). [24]
Progesterone DMUY35B Approved Progesterone increases the expression of Alpha-amylase 1B (AMY1A). [25]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Alpha-amylase 1B (AMY1A). [26]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Alpha-amylase 1B (AMY1A). [27]
Cordycepin DM72Y01 Investigative Cordycepin increases the expression of Alpha-amylase 1B (AMY1A). [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Heterotopic salivary gland adenocarcinoma in the cervical region.Int J Oral Maxillofac Surg. 1997 Aug;26(4):290-2. doi: 10.1016/s0901-5027(97)80872-7.
2 Increased salivary fluid flow in children with newly diagnosed allergic rhinitis.Int J Pediatr Otorhinolaryngol. 2019 Feb;117:105-109. doi: 10.1016/j.ijporl.2018.11.022. Epub 2018 Nov 22.
3 Is there a link between stress and immune biomarkers and salivary opiorphin in patients with a restrictive-type of anorexia nervosa?.World J Biol Psychiatry. 2020 Mar;21(3):220-229. doi: 10.1080/15622975.2019.1593502. Epub 2019 Apr 23.
4 Salivary -amylase as a marker of stress reduction in individuals with intellectual disability and autism in response to occupational and music therapy.J Intellect Disabil Res. 2018 Feb;62(2):156-163. doi: 10.1111/jir.12453. Epub 2017 Nov 21.
5 A novel type of human alpha-amylase produced in lung carcinoid tumor.Gene. 1989 Mar 15;76(1):11-8. doi: 10.1016/0378-1119(89)90003-6.
6 Child depressive symptoms: Associations with salivary cortisol and alpha amylase in two distinct challenges.Biol Psychol. 2020 Jan;149:107808. doi: 10.1016/j.biopsycho.2019.107808. Epub 2019 Nov 7.
7 Adenotonsillectomy can decrease enuresis and sympathetic nervous activity in children with obstructive sleep apnea syndrome.J Pediatr Urol. 2017 Feb;13(1):41.e1-41.e8. doi: 10.1016/j.jpurol.2016.10.009. Epub 2016 Nov 9.
8 A restriction endonuclease assay for expression of human alpha-amylase isozymes.Clin Chim Acta. 2002 Aug;322(1-2):113-6. doi: 10.1016/s0009-8981(02)00161-4.
9 The Association of Salivary Biomarkers With the Severity of Obstructive Sleep Apnea and Concomitant Hypertension.Am J Med Sci. 2019 Jun;357(6):468-473. doi: 10.1016/j.amjms.2019.03.004. Epub 2019 Mar 22.
10 Association between salivary amylase (AMY1) gene copy numbers and insulin resistance in asymptomatic Korean men.Diabet Med. 2015 Dec;32(12):1588-95. doi: 10.1111/dme.12808. Epub 2015 Jun 4.
11 Amylase mRNA transcripts in normal tissues and neoplasms: the implication of different expressions of amylase isogenes.J Cancer Res Clin Oncol. 1994;120(4):213-20. doi: 10.1007/BF01372559.
12 Elevated salivary alpha-amylase levels at awakening in patients with depression.Psychoneuroendocrinology. 2018 Nov;97:69-77. doi: 10.1016/j.psyneuen.2018.07.001. Epub 2018 Jul 6.
13 Salivary -amylase copy number is not associated with weight trajectories and glycemic improvements following clinical weight loss: results from a 2-phase dietary intervention study.Am J Clin Nutr. 2019 Apr 1;109(4):1029-1037. doi: 10.1093/ajcn/nqy363.
14 Batch injection analysis towards auxiliary diagnosis of periodontal diseases based on indirect amperometric detection of salivary -amylase on a cupric oxide electrode.Anal Chim Acta. 2018 Dec 24;1041:50-57. doi: 10.1016/j.aca.2018.08.039. Epub 2018 Aug 29.
15 Assessing the Effects of Music Listening on Psychobiological Stress in Daily Life.J Vis Exp. 2017 Feb 2;(120):54920. doi: 10.3791/54920.
16 Overexpression of salivary-type amylase reduces the sensitivity to bortezomib in multiple myeloma cells.Int J Hematol. 2015 Nov;102(5):569-78. doi: 10.1007/s12185-015-1859-0. Epub 2015 Sep 4.
17 Statistical Binning for Barcoded Reads Improves Downstream Analyses.Cell Syst. 2018 Aug 22;7(2):219-226.e5. doi: 10.1016/j.cels.2018.07.005.
18 Repeated stress leads to enhanced cortisol stress response in child social anxiety disorder but this effect can be prevented with CBT.Psychoneuroendocrinology. 2019 Nov;109:104352. doi: 10.1016/j.psyneuen.2019.06.003. Epub 2019 Jul 24.
19 Characteristics of Labial Gland Mesenchymal Stem Cells of Healthy Individuals and Patients with Sjgren's Syndrome: A Preliminary Study.Stem Cells Dev. 2017 Aug 15;26(16):1171-1185. doi: 10.1089/scd.2017.0045. Epub 2017 Jun 26.
20 Altered Salivary Alpha-Amylase Secretion in Patients with Ulcerative Colitis.Gastroenterol Res Pract. 2018 May 24;2018:4203737. doi: 10.1155/2018/4203737. eCollection 2018.
21 Development of a biodosimeter for radiation triage using novel blood protein biomarker panels in humans and non-human primates.Int J Radiat Biol. 2020 Jan;96(1):22-34. doi: 10.1080/09553002.2018.1532611. Epub 2019 Jan 3.
22 Endogenous salivary -amylase does not interact with skin conductance response during fear extinction in posttraumatic stress disorder.Psychiatry Res. 2018 Apr;262:316-322. doi: 10.1016/j.psychres.2018.02.016. Epub 2018 Feb 10.
23 Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
24 Cordycepin attenuates Salivary Hypofunction through the Prevention of Oxidative Stress in Human Submandibular Gland Cells. Int J Med Sci. 2020 Jul 6;17(12):1733-1743. doi: 10.7150/ijms.46707. eCollection 2020.
25 Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
26 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
27 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.