Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6YOJ9N)

• DOT Name: Transforming protein RhoA (RHOA)
• Synonyms: EC 3.6.5.2; Rho cDNA clone 12; h12
• Gene Name: RHOA
• Related Disease: Ectodermal dysplasia with facial dysmorphism and acral, ocular, and brain anomalies
• UniProt ID: RHOA_HUMAN
• PDB ID: 1A2B ; 1CC0 ; 1CXZ ; 1DPF ; 1FTN ; 1KMQ ; 1LB1 ; 1OW3 ; 1S1C ; 1TX4 ; 1X86 ; 1XCG ; 2RGN ; 3KZ1 ; 3LW8 ; 3LWN ; 3LXR ; 3MSX ; 3T06 ; 4D0N ; 4XH9 ; 4XOI ; 4XSG ; 4XSH ; 5A0F ; 5BWM ; 5C2K ; 5C4M ; 5EZ6 ; 5FR1 ; 5FR2 ; 5HPY ; 5IRC ; 5JCP ; 5JHG ; 5JHH ; 5M6X ; 5M70 ; 5ZHX ; 6BC0 ; 6BCA ; 6BCB ; 6KX2 ; 6KX3 ; 6R3V ; 6V6M ; 6V6U ; 6V6V ; 7G80 ; 7G81 ; 7G82 ; 7G83 ; 7G84 ; 7G85 ; 7G86 ; 7G87 ; 7G88 ; 7G89 ; 7G8A ; 7G8B ; 7G8C ; 7G8D ; 7G8E ; 7G8F ; 7G8G ; 7G8H ; 7G8I ; 7G8J ; 7G8K ; 7G8L ; 7G8M ; 7G8N ; 7G8O ; 7G8P ; 7G8Q ; 7G8R ; 7G8S ; 7G8T ; 7G8U ; 7G8V ; 7G8W ; 7G8X ; 7G8Y ; 7G8Z ; 7G90 ; 7G91 ; 7G92 ; 7G93 ; 7G94 ; 7G95 ; 7G96 ; 7G97 ; 7G98 ; 7G99 ; 7G9A ; 7G9B ; 7G9C ; 7G9D ; 7G9E ; 7G9F ; 7G9G ; 7G9H ; 7G9I ; 7G9J ; 7QSC ; 7QTM ; 7WZA ; 7WZC ; 8BNT ; 8FC7 ; 8FC9 ; 8FCB ; 8T1C
• EC Number: 3.6.5.2
• Pfam ID: PF00071
• Sequence:
  MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
  AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
  LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
  ARRGKKKSGCLVL
• Function: Small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Mainly associated with cytoskeleton organization, in active state binds to a variety of effector proteins to regulate cellular responses such as cytoskeletal dynamics, cell migration and cell cycle. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis. Acts as an allosteric activator of guanine nucleotide exchange factor ECT2 by binding in its activated GTP-bound form to the PH domain of ECT2 which stimulates the release of PH inhibition and promotes the binding of substrate RHOA to the ECT2 catalytic center. May be an activator of PLCE1. In neurons, involved in the inhibition of the initial spine growth. Upon activation by CaMKII, modulates dendritic spine structural plasticity by relaying CaMKII transient activation to synapse-specific, long-term signaling. Acts as a regulator of platelet alpha-granule release during activation and aggregation of platelets; (Microbial infection) Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague.
• KEGG Pathway:
  Ras sig.ling pathway (hsa04014)
  Rap1 sig.ling pathway (hsa04015)
  cGMP-PKG sig.ling pathway (hsa04022)
  cAMP sig.ling pathway (hsa04024)
  Chemokine sig.ling pathway (hsa04062)
  Sphingolipid sig.ling pathway (hsa04071)
  Phospholipase D sig.ling pathway (hsa04072)
  Endocytosis (hsa04144)
  mTOR sig.ling pathway (hsa04150)
  Vascular smooth muscle contraction (hsa04270)
  Wnt sig.ling pathway (hsa04310)
  TGF-beta sig.ling pathway (hsa04350)
  Axon guidance (hsa04360)
  Focal adhesion (hsa04510)
  Adherens junction (hsa04520)
  Tight junction (hsa04530)
  Platelet activation (hsa04611)
  NOD-like receptor sig.ling pathway (hsa04621)
  C-type lectin receptor sig.ling pathway (hsa04625)
  T cell receptor sig.ling pathway (hsa04660)
  Leukocyte transendothelial migration (hsa04670)
  Neurotrophin sig.ling pathway (hsa04722)
  Regulation of actin cytoskeleton (hsa04810)
  Oxytocin sig.ling pathway (hsa04921)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
  Pancreatic secretion (hsa04972)
  Bacterial invasion of epithelial cells (hsa05100)
  Pathogenic Escherichia coli infection (hsa05130)
  Shigellosis (hsa05131)
  Salmonella infection (hsa05132)
  Pertussis (hsa05133)
  Yersinia infection (hsa05135)
  Tuberculosis (hsa05152)
  Human cytomegalovirus infection (hsa05163)
  Pathways in cancer (hsa05200)
  Viral carcinogenesis (hsa05203)
  Proteoglycans in cancer (hsa05205)
  MicroR.s in cancer (hsa05206)
  Colorectal cancer (hsa05210)
  Lipid and atherosclerosis (hsa05417)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Axonal growth inhibition (RHOA activation) (R-HSA-193634)
  PI3K/AKT activation (R-HSA-198203)
  Axonal growth stimulation (R-HSA-209563)
  TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) (R-HSA-2173791)
  G beta (R-HSA-392451)
  EPHB-mediated forward signaling (R-HSA-3928662)
  EPHA-mediated growth cone collapse (R-HSA-3928663)
  PCP/CE pathway (R-HSA-4086400)
  G alpha (12/13) signalling events (R-HSA-416482)
  Sema4D mediated inhibition of cell attachment and migration (R-HSA-416550)
  Sema4D induced cell migration and growth-cone collapse (R-HSA-416572)
  VEGFA-VEGFR2 Pathway (R-HSA-4420097)
  RHO GTPases activate PKNs (R-HSA-5625740)
  RHO GTPases activate CIT (R-HSA-5625900)
  RHO GTPases activate KTN1 (R-HSA-5625970)
  RHO GTPases Activate ROCKs (R-HSA-5627117)
  RHO GTPases Activate Formins (R-HSA-5663220)
  RHO GTPases Activate Rhotekin and Rhophilins (R-HSA-5666185)
  Ovarian tumor domain proteases (R-HSA-5689896)
  ERBB2 Regulates Cell Motility (R-HSA-6785631)
  Neutrophil degranulation (R-HSA-6798695)
  PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases (R-HSA-8849471)
  RHOA GTPase cycle (R-HSA-8980692)
  SLIT2 (R-HSA-8985586)
  RHOC GTPase cycle (R-HSA-9013106)
  GPVI-mediated activation cascade (R-HSA-114604)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ectodermal dysplasia with facial dysmorphism and acral, ocular, and brain anomalies	DISMHQHW	Limited	Unknown	[1]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Transforming protein RhoA (RHOA) decreases the response to substance of Fluorouracil.	[39]
Guanosine-5'-Triphosphate	DMV2OJX	Investigative	Transforming protein RhoA (RHOA) affects the binding of Guanosine-5'-Triphosphate.	[11]
Leptin	DM5LY1H	Investigative	Transforming protein RhoA (RHOA) increases the Ovarian cancer ADR of Leptin.	[40]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Transforming protein RhoA (RHOA).	[2]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the geranoylation of Transforming protein RhoA (RHOA).	[10]
Menadione	DMSJDTY	Approved	Menadione decreases the prenylation of Transforming protein RhoA (RHOA).	[11]
Lovastatin	DM9OZWQ	Approved	Lovastatin decreases the prenylation of Transforming protein RhoA (RHOA).	[18]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transforming protein RhoA (RHOA).	[27]
Mevastatin	DM1LGKP	Terminated	Mevastatin decreases the lipidation of Transforming protein RhoA (RHOA).	[31]

36 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Transforming protein RhoA (RHOA).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transforming protein RhoA (RHOA).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Transforming protein RhoA (RHOA).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transforming protein RhoA (RHOA).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Transforming protein RhoA (RHOA).	[7]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Transforming protein RhoA (RHOA).	[8]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Transforming protein RhoA (RHOA).	[9]
Folic acid	DMEMBJC	Approved	Folic acid decreases the activity of Transforming protein RhoA (RHOA).	[12]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Transforming protein RhoA (RHOA).	[13]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Transforming protein RhoA (RHOA).	[3]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Transforming protein RhoA (RHOA).	[14]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Transforming protein RhoA (RHOA).	[15]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Transforming protein RhoA (RHOA).	[16]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Transforming protein RhoA (RHOA).	[3]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid decreases the activity of Transforming protein RhoA (RHOA).	[17]
Ximelegatran	DMU8ANS	Approved	Ximelegatran decreases the expression of Transforming protein RhoA (RHOA).	[19]
Mebendazole	DMO14SG	Approved	Mebendazole decreases the expression of Transforming protein RhoA (RHOA).	[20]
Pamidronate	DMB4AVP	Approved	Pamidronate decreases the expression of Transforming protein RhoA (RHOA).	[22]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Transforming protein RhoA (RHOA).	[23]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the activity of Transforming protein RhoA (RHOA).	[24]
Acadesine	DM1RMF5	Phase 3	Acadesine decreases the expression of Transforming protein RhoA (RHOA).	[25]
Cethrin	DMD3XMW	Phase 1/2	Cethrin decreases the activity of Transforming protein RhoA (RHOA).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Transforming protein RhoA (RHOA).	[28]
Perillyl alcohol	DMFWC3O	Discontinued in Phase 2	Perillyl alcohol increases the expression of Transforming protein RhoA (RHOA).	[15]
EMODIN	DMAEDQG	Terminated	EMODIN decreases the expression of Transforming protein RhoA (RHOA).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transforming protein RhoA (RHOA).	[32]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Transforming protein RhoA (RHOA).	[33]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Transforming protein RhoA (RHOA).	[34]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Transforming protein RhoA (RHOA).	[35]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR decreases the expression of Transforming protein RhoA (RHOA).	[36]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Transforming protein RhoA (RHOA).	[3]
Chrysin	DM7V2LG	Investigative	Chrysin decreases the expression of Transforming protein RhoA (RHOA).	[37]
LPA	DMI5XR1	Investigative	LPA increases the activity of Transforming protein RhoA (RHOA).	[26]
Fasudil	DMTCNOM	Investigative	Fasudil decreases the expression of Transforming protein RhoA (RHOA).	[38]
Perillaldehyde	DMZA0VD	Investigative	Perillaldehyde increases the expression of Transforming protein RhoA (RHOA).	[15]
dihydrocarveol	DMS4U68	Investigative	dihydrocarveol increases the expression of Transforming protein RhoA (RHOA).	[15]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Terbinafine	DMI6HUW	Approved	Terbinafine increases the localization of Transforming protein RhoA (RHOA).	[21]
GGTI-298	DM1CG0J	Terminated	GGTI-298 affects the localization of Transforming protein RhoA (RHOA).	[30]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Quercetin inhibits migration and invasion of SAS human oral cancer cells through inhibition of NF-B and matrix metalloproteinase-2/-9 signaling pathways. Anticancer Res. 2013 May;33(5):1941-50.
• [7] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [8] Proteomic analysis of liver cancer cells treated with suberonylanilide hydroxamic acid. Cancer Chemother Pharmacol. 2008 Apr;61(5):791-802.
• [9] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [10] Zoledronic acid up-regulates bone sialoprotein expression in osteoblastic cells through Rho GTPase inhibition. Biochem J. 2004 Dec 15;384(Pt 3):591-8. doi: 10.1042/BJ20040380.
• [11] Antioxidants prevent the RhoA inhibition evoked by crocidolite asbestos in human mesothelial and mesothelioma cells. Am J Respir Cell Mol Biol. 2011 Sep;45(3):625-31.
• [12] Folic acid inhibits endothelial cell migration through inhibiting the RhoA activity mediated by activating the folic acid receptor/cSrc/p190RhoGAP-signaling pathway. Biochem Pharmacol. 2013 Feb 1;85(3):376-84. doi: 10.1016/j.bcp.2012.11.011. Epub 2012 Nov 23.
• [13] Cannabidiol and Oxygen-Ozone Combination Induce Cytotoxicity in Human Pancreatic Ductal Adenocarcinoma Cell Lines. Cancers (Basel). 2020 Sep 27;12(10):2774. doi: 10.3390/cancers12102774.
• [14] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [15] Monoterpene regulation of Ras and Ras-related protein expression. J Lipid Res. 2003 Jun;44(6):1209-15. doi: 10.1194/jlr.M300057-JLR200. Epub 2003 Apr 1.
• [16] Cytoskeletal activation and altered gene expression in endothelial barrier regulation by simvastatin. Am J Respir Cell Mol Biol. 2004 May;30(5):662-70. doi: 10.1165/rcmb.2003-0267OC. Epub 2003 Nov 20.
• [17] Ursodeoxycholic acid-induced inhibition of DLC1 protein degradation leads to suppression of hepatocellular carcinoma cell growth. Oncol Rep. 2011 Jun;25(6):1739-46. doi: 10.3892/or.2011.1239. Epub 2011 Mar 29.
• [18] Combining prenylation inhibitors causes synergistic cytotoxicity, apoptosis and disruption of RAS-to-MAP kinase signalling in multiple myeloma cells. Br J Haematol. 2005 Sep;130(6):912-25. doi: 10.1111/j.1365-2141.2005.05696.x.
• [19] The suppressive effect of Rho kinase inhibitor, Y-27632, on oncogenic Ras/RhoA induced invasion/migration of human bladder cancer TSGH cells. Chem Biol Interact. 2010 Jan 5;183(1):172-80. doi: 10.1016/j.cbi.2009.10.018.
• [20] Flubendazole and mebendazole impair migration and epithelial to mesenchymal transition in oral cell lines. Chem Biol Interact. 2018 Sep 25;293:124-132. doi: 10.1016/j.cbi.2018.07.026. Epub 2018 Jul 31.
• [21] Terbinafine inhibits endothelial cell migration through suppression of the Rho-mediated pathway. Mol Cancer Ther. 2006 Dec;5(12):3130-8. doi: 10.1158/1535-7163.MCT-06-0457.
• [22] Pamidronate induced anti-proliferative, apoptotic, and anti-migratory effects in hepatocellular carcinoma. J Hepatol. 2006 Jan;44(1):142-50. doi: 10.1016/j.jhep.2005.09.022. Epub 2005 Nov 9.
• [23] Novel carbocyclic curcumin analog CUR3d modulates genes involved in multiple apoptosis pathways in human hepatocellular carcinoma cells. Chem Biol Interact. 2015 Dec 5;242:107-22.
• [24] RhoA GTPase inactivation by statins induces osteosarcoma cell apoptosis by inhibiting p42/p44-MAPKs-Bcl-2 signaling independently of BMP-2 and cell differentiation. Cell Death Differ. 2006 Nov;13(11):1845-56. doi: 10.1038/sj.cdd.4401873. Epub 2006 Feb 10.
• [25] Solasodine suppresses the metastasis of gastric cancer through claudin-2 via the AMPK/STAT3/NF-B pathway. Chem Biol Interact. 2023 Jul 1;379:110520. doi: 10.1016/j.cbi.2023.110520. Epub 2023 Apr 28.
• [26] Use of synthetic isoprenoids to target protein prenylation and Rho GTPases in breast cancer invasion. PLoS One. 2014 Feb 26;9(2):e89892. doi: 10.1371/journal.pone.0089892. eCollection 2014.
• [27] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [29] Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
• [30] Simvastatin potentiates tumor necrosis factor alpha-mediated apoptosis of human vascular endothelial cells via the inhibition of the geranylgeranylation of RhoA. Life Sci. 2006 Sep 5;79(15):1484-92. doi: 10.1016/j.lfs.2006.04.019. Epub 2006 Apr 29.
• [31] Asbestos induces nitric oxide synthesis in mesothelioma cells via Rho signaling inhibition. Am J Respir Cell Mol Biol. 2007 Jun;36(6):746-56. doi: 10.1165/rcmb.2006-0011OC. Epub 2007 Feb 22.
• [32] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [33] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [34] Deguelin inhibits the migration and invasion of U-2 OS human osteosarcoma cells via the inhibition of matrix metalloproteinase-2/-9 in vitro. Molecules. 2014 Oct 15;19(10):16588-608.
• [35] Gallic acid inhibits gastric cancer cells metastasis and invasive growth via increased expression of RhoB, downregulation of AKT/small GTPase signals and inhibition of NF-B activity. Toxicol Appl Pharmacol. 2013 Jan 1;266(1):76-85. doi: 10.1016/j.taap.2012.10.019. Epub 2012 Nov 13.
• [36] Microcystin-leucine arginine exhibits adverse effects on human aortic vascular smooth muscle cells in vitro. Toxicol In Vitro. 2022 Oct;84:105450. doi: 10.1016/j.tiv.2022.105450. Epub 2022 Jul 26.
• [37] Chrysin inhibit human melanoma A375.S2 cell migration and invasion via affecting MAPK signaling and NF-B signaling pathway in vitro. Environ Toxicol. 2019 Apr;34(4):434-442. doi: 10.1002/tox.22697. Epub 2018 Dec 22.
• [38] Allelic Variants in Arhgef11 via the Rho-Rock Pathway Are Linked to Epithelial-Mesenchymal Transition and Contributes to Kidney Injury in the Dahl Salt-Sensitive Rat. PLoS One. 2015 Jul 14;10(7):e0132553. doi: 10.1371/journal.pone.0132553. eCollection 2015.
• [39] Reversal of the malignant phenotype of gastric cancer cells by inhibition of RhoA expression and activity. Clin Cancer Res. 2004 Sep 15;10(18 Pt 1):6239-47. doi: 10.1158/1078-0432.CCR-04-0242.
• [40] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.