Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT86YP8G)

• DOT Name: Stanniocalcin-2 (STC2)
• Synonyms: STC-2; Stanniocalcin-related protein; STC-related protein; STCRP
• Gene Name: STC2
• UniProt ID: STC2_HUMAN
• PDB ID: 7Y5Q; 8A7D; 8A7E; 8HGH
• Pfam ID: PF03298
• Sequence:
  MCAERLGQFMTLALVLATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNA
  GDVGCGVFECFENNSCEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGC
  ISRKCPAIREMVSQLQRECYLKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDLVNLLLT
  CGEEVKEAITHSVQVQCEQNWGSLCSILSFCTSAIQKPPTAPPERQPQVDRTKLSRAHHG
  EAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDI
  RR
• Function: Has an anti-hypocalcemic action on calcium and phosphate homeostasis.
• Tissue Specificity: Expressed in a variety of tissues including muscle, heart, pancreas, kidney, spleen, prostate, small intestine, colon and peripheral blood leukocytes.
• Reactome Pathway:
  Post-translational protein phosphorylation (R-HSA-8957275)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	Stanniocalcin-2 (STC2) affects the response to substance of Mitomycin.	[43]
Vinblastine	DM5TVS3	Approved	Stanniocalcin-2 (STC2) affects the response to substance of Vinblastine.	[43]

44 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Stanniocalcin-2 (STC2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Stanniocalcin-2 (STC2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Stanniocalcin-2 (STC2).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Stanniocalcin-2 (STC2).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Stanniocalcin-2 (STC2).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Stanniocalcin-2 (STC2).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Stanniocalcin-2 (STC2).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Stanniocalcin-2 (STC2).	[8]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Stanniocalcin-2 (STC2).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Stanniocalcin-2 (STC2).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Stanniocalcin-2 (STC2).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol affects the expression of Stanniocalcin-2 (STC2).	[12]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Stanniocalcin-2 (STC2).	[13]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Stanniocalcin-2 (STC2).	[14]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Stanniocalcin-2 (STC2).	[15]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Stanniocalcin-2 (STC2).	[6]
Marinol	DM70IK5	Approved	Marinol increases the expression of Stanniocalcin-2 (STC2).	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Stanniocalcin-2 (STC2).	[17]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Stanniocalcin-2 (STC2).	[18]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Stanniocalcin-2 (STC2).	[19]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Stanniocalcin-2 (STC2).	[20]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Stanniocalcin-2 (STC2).	[21]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Stanniocalcin-2 (STC2).	[22]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Stanniocalcin-2 (STC2).	[23]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Stanniocalcin-2 (STC2).	[24]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Stanniocalcin-2 (STC2).	[25]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Stanniocalcin-2 (STC2).	[26]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Stanniocalcin-2 (STC2).	[27]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Stanniocalcin-2 (STC2).	[28]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Stanniocalcin-2 (STC2).	[29]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Stanniocalcin-2 (STC2).	[13]
Lithium	DMZ3OU6	Phase 2	Lithium decreases the expression of Stanniocalcin-2 (STC2).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Stanniocalcin-2 (STC2).	[31]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Stanniocalcin-2 (STC2).	[32]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Stanniocalcin-2 (STC2).	[33]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Stanniocalcin-2 (STC2).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Stanniocalcin-2 (STC2).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Stanniocalcin-2 (STC2).	[37]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Stanniocalcin-2 (STC2).	[38]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Stanniocalcin-2 (STC2).	[39]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Stanniocalcin-2 (STC2).	[40]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Stanniocalcin-2 (STC2).	[41]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Stanniocalcin-2 (STC2).	[42]
U0126	DM31OGF	Investigative	U0126 increases the expression of Stanniocalcin-2 (STC2).	[19]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Stanniocalcin-2 (STC2).	[34]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [7] Expression profiling of the estrogen responsive genes in response to phytoestrogens using a customized DNA microarray. FEBS Lett. 2005 Mar 14;579(7):1732-40.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [11] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [12] Role of calcitriol and cortisol on human adipocyte proliferation and oxidative and inflammatory stress: a microarray study. J Nutrigenet Nutrigenomics. 2008;1(1-2):30-48. doi: 10.1159/000109873. Epub 2007 Oct 16.
• [13] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [14] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [15] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [16] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [17] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [18] Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
• [19] Ovarian steroids, mitogen-activated protein kinases, and/or aspartic proteinases cooperate to control endometrial remodeling by regulating gene expression in the stroma and glands. Endocrinology. 2010 Sep;151(9):4515-26. doi: 10.1210/en.2009-1398. Epub 2010 Jul 21.
• [20] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [21] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [22] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [23] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [24] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [25] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [26] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [27] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [28] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [29] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [30] A genetic network model of cellular responses to lithium treatment and cocaine abuse in bipolar disorder. BMC Syst Biol. 2010 Nov 19;4:158. doi: 10.1186/1752-0509-4-158.
• [31] Gene expression profiling of A549 cells exposed to Milan PM2.5. Toxicol Lett. 2012 Mar 7;209(2):136-45.
• [32] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [33] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [34] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [35] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [36] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [37] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [38] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [39] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [40] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [41] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
• [42] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [43] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.