Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8J7T7U)

DOT Name	Sperm surface protein Sp17 (SPA17)
Synonyms	Cancer/testis antigen 22; CT22; Sp17-1; Sperm autoantigenic protein 17; Sperm protein 17
Gene Name	SPA17
Related Disease	Cervical cancer ( ) Cervical carcinoma ( ) Endometrial cancer ( ) Breast cancer ( ) Breast carcinoma ( ) Breast neoplasm ( ) Carcinoma of esophagus ( ) Clear cell adenocarcinoma ( ) Epithelial ovarian cancer ( ) Esophageal squamous cell carcinoma ( ) Head-neck squamous cell carcinoma ( ) Malignant uterine tumour ( ) Myelodysplastic syndrome ( ) Neoplasm of esophagus ( ) Non-small-cell lung cancer ( ) Ovarian cancer ( ) Ovarian neoplasm ( ) Pituitary tumor ( ) Plasma cell myeloma ( ) Severe combined immunodeficiency ( ) Testicular cancer ( ) Triple negative breast cancer ( ) Advanced cancer ( ) Ductal breast carcinoma in situ ( ) Endometrial carcinoma ( ) Invasive ductal breast carcinoma ( ) Esophageal cancer ( ) Lung cancer ( ) Lung carcinoma ( ) Rheumatoid arthritis ( )
UniProt ID	SP17_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	8J07
Pfam ID	PF00612 ; PF02197
Sequence	MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW GSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK IQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Function	Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates.
Tissue Specificity	Testis and sperm specific.

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cervical cancer	DISFSHPF	Definitive	Biomarker	[1]
Cervical carcinoma	DIST4S00	Definitive	Biomarker	[1]
Endometrial cancer	DISW0LMR	Definitive	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[2]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[2]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[3]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[4]
Clear cell adenocarcinoma	DISYUGHZ	Strong	Altered Expression	[5]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[6]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[4]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[7]
Malignant uterine tumour	DIS3QDT8	Strong	Biomarker	[8]
Myelodysplastic syndrome	DISYHNUI	Strong	Altered Expression	[9]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[4]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[7]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[6]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[6]
Pituitary tumor	DISN67JD	Strong	Biomarker	[10]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[7]
Severe combined immunodeficiency	DIS6MF4Q	Strong	Biomarker	[11]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[12]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[5]
Ductal breast carcinoma in situ	DISLCJY7	moderate	Altered Expression	[2]
Endometrial carcinoma	DISXR5CY	moderate	Altered Expression	[8]
Invasive ductal breast carcinoma	DIS43J58	moderate	Altered Expression	[2]
Esophageal cancer	DISGB2VN	Limited	Altered Expression	[3]
Lung cancer	DISCM4YA	Limited	Biomarker	[13]
Lung carcinoma	DISTR26C	Limited	Biomarker	[13]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[14]
------------------------------------------------------------------------------------


⏷ Show the Full List of 30 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Sperm surface protein Sp17 (SPA17).	[15]
------------------------------------------------------------------------------------

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sperm surface protein Sp17 (SPA17).	[16]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Sperm surface protein Sp17 (SPA17).	[17]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Sperm surface protein Sp17 (SPA17).	[18]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Sperm surface protein Sp17 (SPA17).	[19]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Sperm surface protein Sp17 (SPA17).	[20]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Sperm surface protein Sp17 (SPA17).	[21]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Sperm surface protein Sp17 (SPA17).	[22]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Sperm surface protein Sp17 (SPA17).	[23]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Sperm surface protein Sp17 (SPA17).	[24]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Sperm surface protein Sp17 (SPA17).	[25]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Sperm surface protein Sp17 (SPA17).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Sperm surface protein Sp17 (SPA17).	[27]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Sperm surface protein Sp17 (SPA17).	[28]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Sperm surface protein Sp17 (SPA17).	[20]
Manganese	DMKT129	Investigative	Manganese decreases the expression of Sperm surface protein Sp17 (SPA17).	[29]
------------------------------------------------------------------------------------


⏷ Show the Full List of 15 Drug(s)

References

1	Sperm protein 17 is highly expressed in endometrial and cervical cancers.BMC Cancer. 2010 Aug 16;10:429. doi: 10.1186/1471-2407-10-429.
2	Sperm Protein Antigen 17 Expression Correlates With Lymph Node Metastasis and Worse Overall Survival in Patients With Breast Cancer.Front Oncol. 2019 Jul 31;9:710. doi: 10.3389/fonc.2019.00710. eCollection 2019.
3	Cancer testis antigen Sperm Protein 17 as a new target for triple negative breast cancer immunotherapy.Oncotarget. 2017 Aug 10;8(43):74378-74390. doi: 10.18632/oncotarget.20102. eCollection 2017 Sep 26.
4	Clinical significance of sperm protein 17 expression and immunogenicity in esophageal cancer.Int J Cancer. 2007 Apr 15;120(8):1739-47. doi: 10.1002/ijc.22463.
5	Validity and prognostic significance of sperm protein 17 as a tumor biomarker for epithelial ovarian cancer: a retrospective study.BMC Cancer. 2018 Oct 11;18(1):970. doi: 10.1186/s12885-018-4880-x.
6	Development of a M cell-targeted microparticulate platform, BSK02? for oral immunization against the ovarian cancer antigen, sperm protein 17.J Biomed Mater Res B Appl Biomater. 2019 Jan;107(1):29-36. doi: 10.1002/jbm.b.34092. Epub 2018 Mar 4.
7	The cancer-testis antigen, sperm protein 17, a new biomarker and immunological target in head and neck squamous cell carcinoma.Oncotarget. 2017 Oct 31;8(59):100280-100287. doi: 10.18632/oncotarget.22213. eCollection 2017 Nov 21.
8	In Vitro Assessment of the Expression and T Cell Immunogenicity of the Tumor-Associated Antigens BORIS, MUC1, hTERT, MAGE-A3 and Sp17 in Uterine Cancer.Int J Mol Sci. 2016 Sep 9;17(9):1525. doi: 10.3390/ijms17091525.
9	Decitabine treatment sensitizes tumor cells to T-cell-mediated cytotoxicity in patients with myelodysplastic syndromes.Am J Transl Res. 2017 Feb 15;9(2):454-465. eCollection 2017.
10	Novel antigens in non-small cell lung cancer: SP17, AKAP4, and PTTG1 are potential immunotherapeutic targets.Oncotarget. 2015 Feb 20;6(5):2812-26. doi: 10.18632/oncotarget.2802.
11	A NOD/SCID tumor model for human ovarian cancer that allows tracking of tumor progression through the biomarker Sp17.J Immunol Methods. 2007 Apr 10;321(1-2):86-93. doi: 10.1016/j.jim.2007.01.010. Epub 2007 Feb 9.
12	Cancer-testis antigens as biomarkers for Merkel cell carcinoma: Pitfalls and opportunities.J Cutan Pathol. 2019 Oct;46(10):748-752. doi: 10.1111/cup.13528. Epub 2019 Jul 11.
13	Umbilical cord blood-derived dendritic cells infected by adenovirus for SP17 expression induce antigen-specific cytotoxic T cells against NSCLC cells.Cell Immunol. 2015 Nov-Dec;298(1-2):18-24. doi: 10.1016/j.cellimm.2015.08.004. Epub 2015 Aug 18.
14	Developmental considerations of sperm protein 17 gene expression in rheumatoid arthritis synoviocytes.Dev Immunol. 2002 Jun;9(2):97-102. doi: 10.1080/1044667021000095186.
15	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
16	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
17	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
18	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
19	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
20	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
21	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
22	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
23	Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
24	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
25	Differentially expressed genes in the prostate cancer cell line LNCaP after exposure to androgen and anti-androgen. Cancer Genet Cytogenet. 2006 Apr 15;166(2):130-8. doi: 10.1016/j.cancergencyto.2005.09.012.
26	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
27	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
28	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
29	Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.