Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9HK436)

DOT Name Psoriasis susceptibility 1 candidate gene 1 protein (PSORS1C1)
Synonyms Protein SEEK1
Gene Name PSORS1C1
Related Disease
Acquired immune deficiency syndrome ( )
Arthritis ( )
Behcet disease ( )
Graves disease ( )
Major depressive disorder ( )
Membranous glomerulonephritis ( )
Multiple sclerosis ( )
Myasthenia gravis ( )
Plasma cell myeloma ( )
Psoriasis ( )
Psoriatic arthritis ( )
Rheumatoid arthritis ( )
Schizophrenia ( )
Stevens-Johnson syndrome ( )
Toxic epidermal necrolysis ( )
Type-1 diabetes ( )
Asthma ( )
Cutaneous lupus erythematosus ( )
Systemic sclerosis ( )
Chronic obstructive pulmonary disease ( )
Crohn disease ( )
Hepatocellular carcinoma ( )
Lung cancer ( )
Systemic lupus erythematosus ( )
UniProt ID
PS1C1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15357
Sequence
MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGD
LQAMISKEFHLAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPP
SGIHLSASRTLAPTLLYSSPPSHSPFGLSSLI
Tissue Specificity Expressed in skin. Also found in heart, placenta, liver, skeletal muscle and pancreas.

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acquired immune deficiency syndrome DISL5UOX Strong Genetic Variation [1]
Arthritis DIST1YEL Strong Genetic Variation [2]
Behcet disease DISSYMBS Strong Biomarker [3]
Graves disease DISU4KOQ Strong Genetic Variation [4]
Major depressive disorder DIS4CL3X Strong Genetic Variation [5]
Membranous glomerulonephritis DISFSUKQ Strong Genetic Variation [6]
Multiple sclerosis DISB2WZI Strong Genetic Variation [7]
Myasthenia gravis DISELRCI Strong Genetic Variation [8]
Plasma cell myeloma DIS0DFZ0 Strong Genetic Variation [9]
Psoriasis DIS59VMN Strong Genetic Variation [10]
Psoriatic arthritis DISLWTG2 Strong Biomarker [2]
Rheumatoid arthritis DISTSB4J Strong Genetic Variation [11]
Schizophrenia DISSRV2N Strong Genetic Variation [12]
Stevens-Johnson syndrome DISZG4YX Strong Genetic Variation [13]
Toxic epidermal necrolysis DISIWPFR Strong Genetic Variation [13]
Type-1 diabetes DIS7HLUB Strong Genetic Variation [14]
Asthma DISW9QNS moderate Genetic Variation [15]
Cutaneous lupus erythematosus DISOIX6L moderate Genetic Variation [16]
Systemic sclerosis DISF44L6 moderate Biomarker [17]
Chronic obstructive pulmonary disease DISQCIRF Limited Genetic Variation [18]
Crohn disease DIS2C5Q8 Limited Genetic Variation [19]
Hepatocellular carcinoma DIS0J828 Limited Genetic Variation [20]
Lung cancer DISCM4YA Limited Genetic Variation [21]
Systemic lupus erythematosus DISI1SZ7 Limited Genetic Variation [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 24 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol affects the expression of Psoriasis susceptibility 1 candidate gene 1 protein (PSORS1C1). [23]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Psoriasis susceptibility 1 candidate gene 1 protein (PSORS1C1). [25]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Psoriasis susceptibility 1 candidate gene 1 protein (PSORS1C1). [24]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Psoriasis susceptibility 1 candidate gene 1 protein (PSORS1C1). [26]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Psoriasis susceptibility 1 candidate gene 1 protein (PSORS1C1). [27]
------------------------------------------------------------------------------------

References

1 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).J Infect Dis. 2009 Feb 1;199(3):419-26. doi: 10.1086/596067.
2 Association of SEEK1 and psoriatic arthritis in two distinct Canadian populations.Ann Rheum Dis. 2005 Sep;64(9):1370-2. doi: 10.1136/ard.2004.031765. Epub 2005 Feb 11.
3 Identification of multiple independent susceptibility loci in the HLA region in Behet's disease.Nat Genet. 2013 Mar;45(3):319-24. doi: 10.1038/ng.2551. Epub 2013 Feb 10.
4 Genetic determinants of antithyroid drug-induced agranulocytosis by human leukocyte antigen genotyping and genome-wide association study.Nat Commun. 2015 Jul 7;6:7633. doi: 10.1038/ncomms8633.
5 Bivariate genome-wide association analyses of the broad depression phenotype combined with major depressive disorder, bipolar disorder or schizophrenia reveal eight novel genetic loci for depression.Mol Psychiatry. 2020 Jul;25(7):1420-1429. doi: 10.1038/s41380-018-0336-6. Epub 2019 Jan 9.
6 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.N Engl J Med. 2011 Feb 17;364(7):616-26. doi: 10.1056/NEJMoa1009742.
7 Risk alleles for multiple sclerosis identified by a genomewide study.N Engl J Med. 2007 Aug 30;357(9):851-62. doi: 10.1056/NEJMoa073493. Epub 2007 Jul 29.
8 Risk for myasthenia gravis maps to a (151) ProAla change in TNIP1 and to human leukocyte antigen-B*08.Ann Neurol. 2012 Dec;72(6):927-35. doi: 10.1002/ana.23691. Epub 2012 Oct 10.
9 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.Nat Genet. 2013 Oct;45(10):1221-1225. doi: 10.1038/ng.2733. Epub 2013 Aug 18.
10 HLA-C*06:02-independent, gender-related association of PSORS1C3 and PSORS1C1/CDSN single-nucleotide polymorphisms with risk and severity of psoriasis.Mol Genet Genomics. 2018 Aug;293(4):957-966. doi: 10.1007/s00438-018-1435-4. Epub 2018 Mar 27.
11 Polymorphisms in STAT4, PTPN2, PSORS1C1 and TRAF3IP2 Genes Are Associated with the Response to TNF Inhibitors in Patients with Rheumatoid Arthritis.PLoS One. 2017 Jan 20;12(1):e0169956. doi: 10.1371/journal.pone.0169956. eCollection 2017.
12 Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
13 Genome-wide association study of Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis in Europe.Orphanet J Rare Dis. 2011 Jul 29;6:52. doi: 10.1186/1750-1172-6-52.
14 A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.Nature. 2007 Aug 2;448(7153):591-4. doi: 10.1038/nature06010. Epub 2007 Jul 15.
15 Identification of Four Novel Loci in Asthma in European American and African American Populations.Am J Respir Crit Care Med. 2017 Feb 15;195(4):456-463. doi: 10.1164/rccm.201604-0861OC.
16 Genome-wide association study identifies new susceptibility loci for cutaneous lupus erythematosus.Exp Dermatol. 2015 Jul;24(7):510-5. doi: 10.1111/exd.12708. Epub 2015 May 4.
17 Confirmation of TNIP1 but not RHOB and PSORS1C1 as systemic sclerosis risk factors in a large independent replication study.Ann Rheum Dis. 2013 Apr;72(4):602-7. doi: 10.1136/annrheumdis-2012-201888. Epub 2012 Aug 15.
18 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.Am J Respir Crit Care Med. 2012 Dec 15;186(12):1238-47. doi: 10.1164/rccm.201206-1013OC. Epub 2012 Nov 9.
19 Association of SEEK1 polymorphisms in Crohn's disease.Hum Immunol. 2004 Jul;65(7):706-9. doi: 10.1016/j.humimm.2004.04.002.
20 Clinical Implication and the Hereditary Factors of NM23 in Hepatocellular Carcinoma Based on Bioinformatics Analysis and Genome-Wide Association Study.J Oncol. 2018 Dec 18;2018:6594169. doi: 10.1155/2018/6594169. eCollection 2018.
21 Influence of common genetic variation on lung cancer risk: meta-analysis of 14 900 cases and 29 485 controls.Hum Mol Genet. 2012 Nov 15;21(22):4980-95. doi: 10.1093/hmg/dds334. Epub 2012 Aug 16.
22 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.Genes Immun. 2014 Sep;15(6):347-54. doi: 10.1038/gene.2014.23. Epub 2014 May 29.
23 Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
24 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
25 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
26 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
27 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.