Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTESHUIX)

DOT Name Glycophorin-B (GYPB)
Synonyms PAS-3; SS-active sialoglycoprotein; Sialoglycoprotein delta; CD antigen CD235b
Gene Name GYPB
Related Disease
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive ( )
Abdominal aortic aneurysm ( )
Acute erythroid leukemia ( )
Acute lymphocytic leukaemia ( )
Advanced cancer ( )
Aplastic anemia ( )
Ataxia-telangiectasia ( )
Beta-thalassemia major ( )
Breast cancer ( )
Breast carcinoma ( )
Bronchitis ( )
Chronic obstructive pulmonary disease ( )
Cockayne syndrome ( )
Cystic fibrosis ( )
Depression ( )
Developmental and epileptic encephalopathy, 36 ( )
Distal renal tubular acidosis ( )
Fanconi anemia complementation group A ( )
Fanconi's anemia ( )
G6PD deficiency ( )
Graves disease ( )
Hemoglobinopathy ( )
Hepatitis B virus infection ( )
Hereditary spherocytosis ( )
High blood pressure ( )
leukaemia ( )
Lung cancer ( )
Lung carcinoma ( )
Malaria ( )
Malignant hyperthermia of anesthesia ( )
Melnick-Needles syndrome ( )
Menkes disease ( )
Myelodysplastic syndrome ( )
Neoplasm ( )
Paroxysmal nocturnal haemoglobinuria ( )
Polycythemia vera ( )
Pulmonary disease ( )
Seasonal allergic rhinitis ( )
Typhoid fever ( )
Bloom syndrome ( )
Bone development disease ( )
Osteochondrodysplasia ( )
Skeletal dysplasia ( )
Acute myelogenous leukaemia ( )
Autoimmune polyendocrinopathy ( )
Leukemia ( )
UniProt ID
GLPB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8CRT; 8CS9; 8CSL
Pfam ID
PF01102
Sequence
MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAP
VVIILIILCVMAGIIGTILLISYSIRRLIKA
Function Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane.
KEGG Pathway
Malaria (hsa05144 )
Reactome Pathway
Cell surface interactions at the vascular wall (R-HSA-202733 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive DIS3KLUX Definitive Biomarker [1]
Abdominal aortic aneurysm DISD06OF Strong Biomarker [2]
Acute erythroid leukemia DISZFC1O Strong Biomarker [3]
Acute lymphocytic leukaemia DISPX75S Strong Genetic Variation [4]
Advanced cancer DISAT1Z9 Strong Genetic Variation [5]
Aplastic anemia DISJRSC0 Strong Genetic Variation [6]
Ataxia-telangiectasia DISP3EVR Strong Genetic Variation [7]
Beta-thalassemia major DISW06BV Strong Biomarker [8]
Breast cancer DIS7DPX1 Strong Biomarker [9]
Breast carcinoma DIS2UE88 Strong Biomarker [9]
Bronchitis DISBM6EQ Strong Genetic Variation [10]
Chronic obstructive pulmonary disease DISQCIRF Strong Genetic Variation [11]
Cockayne syndrome DISW6GL2 Strong Biomarker [12]
Cystic fibrosis DIS2OK1Q Strong Genetic Variation [13]
Depression DIS3XJ69 Strong Biomarker [14]
Developmental and epileptic encephalopathy, 36 DISG4MY5 Strong Biomarker [15]
Distal renal tubular acidosis DISP6CYE Strong Genetic Variation [16]
Fanconi anemia complementation group A DIS8PZLI Strong Genetic Variation [17]
Fanconi's anemia DISGW6Q8 Strong Genetic Variation [17]
G6PD deficiency DISYF1GO Strong Biomarker [18]
Graves disease DISU4KOQ Strong Biomarker [19]
Hemoglobinopathy DISCT4GX Strong Genetic Variation [20]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [21]
Hereditary spherocytosis DISQYJP5 Strong Genetic Variation [22]
High blood pressure DISY2OHH Strong Genetic Variation [23]
leukaemia DISS7D1V Strong Genetic Variation [24]
Lung cancer DISCM4YA Strong Biomarker [11]
Lung carcinoma DISTR26C Strong Biomarker [11]
Malaria DISQ9Y50 Strong Biomarker [25]
Malignant hyperthermia of anesthesia DISYC9XI Strong Genetic Variation [26]
Melnick-Needles syndrome DIS0KTGM Strong Biomarker [27]
Menkes disease DISJJV50 Strong Genetic Variation [28]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [29]
Neoplasm DISZKGEW Strong Biomarker [30]
Paroxysmal nocturnal haemoglobinuria DISBHMYH Strong Genetic Variation [6]
Polycythemia vera DISB5FPO Strong Biomarker [31]
Pulmonary disease DIS6060I Strong Genetic Variation [32]
Seasonal allergic rhinitis DIS58KQX Strong Biomarker [33]
Typhoid fever DISP3NHR Strong Biomarker [34]
Bloom syndrome DISKXQ7J moderate Genetic Variation [35]
Bone development disease DISVKAZS moderate Genetic Variation [36]
Osteochondrodysplasia DIS9SPWW moderate Genetic Variation [36]
Skeletal dysplasia DIS5Z8U6 moderate Genetic Variation [36]
Acute myelogenous leukaemia DISCSPTN Limited Biomarker [37]
Autoimmune polyendocrinopathy DISOLDB2 Limited Genetic Variation [38]
Leukemia DISNAKFL Limited Genetic Variation [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Glycophorin-B (GYPB). [39]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
DNCB DMDTVYC Phase 2 DNCB decreases the expression of Glycophorin-B (GYPB). [40]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Glycophorin-B (GYPB). [41]
Eugenol DM7US1H Patented Eugenol decreases the expression of Glycophorin-B (GYPB). [40]
------------------------------------------------------------------------------------

References

1 Erythroid blast crisis in chronic myelogenous leukemia.Blood. 1983 Sep;62(3):591-6.
2 Blood groups and HLA antigens in patients with abdominal aortic aneurysms.Hum Hered. 1984;34(1):9-13. doi: 10.1159/000153411.
3 DKC1 is a transcriptional target of GATA1 and drives upregulation of telomerase activity in normal human erythroblasts.Haematologica. 2020 Jun;105(6):1517-1526. doi: 10.3324/haematol.2018.215699. Epub 2019 Aug 14.
4 Glycophorin A mutations and risk of secondary leukaemia in patients treated for childhood acute lymphoblastic leukaemia.Br J Haematol. 1996 Apr;93(1):117-24. doi: 10.1046/j.1365-2141.1996.4621001.x.
5 Individual variation of somatic gene mutability in relation to cancer susceptibility: prospective study on erythrocyte glycophorin a gene mutations of atomic bomb survivors.Cancer Res. 2005 Jun 15;65(12):5462-9. doi: 10.1158/0008-5472.CAN-04-1188.
6 Increased frequency of somatic mutations at glycophorin A loci in patients with aplastic anaemia, myelodysplastic syndrome and paroxysmal nocturnal haemoglobinuria.Br J Haematol. 1997 Aug;98(2):384-91. doi: 10.1046/j.1365-2141.1997.2233037.x.
7 Diagnosis of ataxia telangiectasia with the glycophorin A somatic mutation assay.Genet Test. 1997-1998;1(4):261-7. doi: 10.1089/gte.1997.1.261.
8 Ineffective erythropoiesis in beta-thalassemia major is due to apoptosis at the polychromatophilic normoblast stage.Exp Hematol. 2000 Dec;28(12):1343-53. doi: 10.1016/s0301-472x(00)00555-5.
9 Breast cancer and the MNSs blood groups.Dis Markers. 1989 Oct-Dec;7(4):253-6.
10 Exposure to cold and draught, alcohol consumption, and the NS-phenotype are associated with chronic bronchitis: an epidemiological investigation of 3387 men aged 53-75 years: the Copenhagen Male Study.Occup Environ Med. 2001 Mar;58(3):160-4. doi: 10.1136/oem.58.3.160.
11 Chromosome 4q31 locus in COPD is also associated with lung cancer.Eur Respir J. 2010 Dec;36(6):1375-82. doi: 10.1183/09031936.00033310.
12 Somatic cell mutation frequency at the HPRT, T-cell antigen receptor and glycophorin A loci in Cockayne syndrome.Mutat Res. 1995 Jul;337(1):49-55. doi: 10.1016/0921-8777(95)00014-b.
13 Linkage studies between polymorphic markers on chromosome 4 and cystic fibrosis.Hum Genet. 1985;69(3):250-4. doi: 10.1007/BF00293035.
14 Evidence for possible linkage between genetic markers and affective disorders.Biol Psychiatry. 1988 Dec;24(8):903-17. doi: 10.1016/0006-3223(88)90225-9.
15 Band 3 glycoprotein and glycophorin A from erythrocytes of children with congenital disorder of glycosylation type-Ia are underglycosylated.Proteomics. 2001 Feb;1(2):269-74. doi: 10.1002/1615-9861(200102)1:2<269::AID-PROT269>3.0.CO;2-8.
16 Novel AE1 mutations in recessive distal renal tubular acidosis. Loss-of-function is rescued by glycophorin A.J Clin Invest. 1998 Dec 15;102(12):2173-9. doi: 10.1172/JCI4836.
17 Frequencies of HPRT- lymphocytes and glycophorin A variants erythrocytes in Fanconi anemia patients, their parents and control donors.Mutat Res. 1993 Sep;289(1):115-26. doi: 10.1016/0027-5107(93)90137-5.
18 Blood groups and types, hemoglobin variants, and G-6-PD deficiency among Abu Dhabians in the United Arab Emirates.Am J Phys Anthropol. 1980 May;52(4):481-4. doi: 10.1002/ajpa.1330520404.
19 Differentiation of autoimmune ophthalmopathy from Graves' hyperthyroidism by analysis of genetic markers.Clin Endocrinol (Oxf). 1988 Jun;28(6):601-10. doi: 10.1111/j.1365-2265.1988.tb03851.x.
20 DNA array analysis for red blood cell antigens facilitates the transfusion support with antigen-matched blood in patients with sickle cell disease.Vox Sang. 2009 Aug;97(2):147-52. doi: 10.1111/j.1423-0410.2009.01185.x. Epub 2009 Apr 8.
21 Genetic survey of an isolated community in Bali, Indonesia. I. Blood groups, serum proteins and hepatitis B serology.Hum Hered. 1982;32(1):52-61. doi: 10.1159/000153259.
22 Glycophorin A: Band 3 aid.Blood Cells Mol Dis. 2008 Jul-Aug;41(1):35-43. doi: 10.1016/j.bcmd.2008.01.001. Epub 2008 Mar 4.
23 Adducin in essential hypertension.FEBS Lett. 1998 Jun 23;430(1-2):41-4. doi: 10.1016/s0014-5793(98)00457-8.
24 Somatic mutations at T-cell antigen receptor and glycophorin A loci in pediatric leukemia patients following chemotherapy: comparison with HPRT locus mutation.Mutat Res. 1994 Sep;315(2):95-103. doi: 10.1016/0921-8777(94)90010-8.
25 An ImmunoPEGliposome for Targeted Antimalarial Combination Therapy at the Nanoscale.Pharmaceutics. 2019 Jul 16;11(7):341. doi: 10.3390/pharmaceutics11070341.
26 A linkage study of malignant hyperthermia (MH).Clin Genet. 1990 Mar;37(3):221-5. doi: 10.1111/j.1399-0004.1990.tb03506.x.
27 Frequency of Red Blood Cell Antigens According to Parent Ethnicity in Korea Using Molecular Typing.Ann Lab Med. 2018 Nov;38(6):599-603. doi: 10.3343/alm.2018.38.6.599.
28 Studies on human red-cell membrane glycophorin A and glycophorin B genes in glycophorin-deficient individuals.Biochem J. 1989 Nov 1;263(3):993-6. doi: 10.1042/bj2630993.
29 Detection of hematopoietic maturation abnormalities by flow cytometry in myelodysplastic syndromes and its utility for the differential diagnosis with non-clonal disorders.Leuk Res. 2007 Feb;31(2):147-55. doi: 10.1016/j.leukres.2006.04.010. Epub 2006 Jun 5.
30 Aptamer-Modified Magnetic Nanosensitizer for In Vivo MR Imaging of HER2-Expressing Cancer.Nanoscale Res Lett. 2018 Sep 18;13(1):288. doi: 10.1186/s11671-018-2682-3.
31 Structural, antigenetic and transcriptional characteristics in peripheral blood CD34+ progenitor cells from polycythemia vera patients: evidence for delayed determination.Int J Oncol. 2003 Aug;23(2):437-43.
32 Analysis of erythrocyte glycophorin-A variants by flow cytometry in lung disease patients detects the effect of tobacco smoke.Anal Cell Pathol. 2000;21(1):35-40. doi: 10.1155/2000/512786.
33 Erythrocyte antigens as immunogenetic markers of respiratory atopic diseases in Georgians.J Investig Allergol Clin Immunol. 1995 Jan-Feb;5(1):35-9.
34 ABO, Rh, MNSs, sex and typhoid fever.Hum Hered. 1993 Sep-Oct;43(5):301-10. doi: 10.1159/000154148.
35 Evidence for increased in vivo mutation and somatic recombination in Bloom's syndrome.Proc Natl Acad Sci U S A. 1989 Jan;86(2):670-4. doi: 10.1073/pnas.86.2.670.
36 Omphalocele and multiple severe congenital anomalies associated with osteodysplasty (Melnick-Needles syndrome).Am J Med Genet. 1982 Dec;13(4):453-63. doi: 10.1002/ajmg.1320130416.
37 S-phase DNA content and aneuploidy of immunophenotypic defined subpopulations in acute myeloid leukemia determined by multi-parameter flow cytometry.Leuk Res. 1991;15(9):827-35. doi: 10.1016/0145-2126(91)90467-8.
38 Serum Thyroid Hormone Antibodies Are Frequent in Patients with Polyglandular Autoimmune Syndrome Type 3, Particularly in Those Who Require Thyroxine Treatment.Front Endocrinol (Lausanne). 2017 Aug 28;8:212. doi: 10.3389/fendo.2017.00212. eCollection 2017.
39 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
40 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
41 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.